KEGG   Buttiauxella sp. 3AFRM03: D8682_15330Help
Entry
D8682_15330       CDS       T05676                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00010  Glycolysis / Gluconeogenesis
buf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D8682_15330
Enzymes [BR:buf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     D8682_15330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase Acid_PPase SHOCT PNK3P HAD
Motif
Other DBs
NCBI-ProteinID: AYN28225
UniProt: A0A3G2IGB7
Position
complement(2964271..2964867)
Genome map
AA seq 198 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVMGVWSDYSRIPLANLQKSFVMGEAFKRHERGQISDEEFAEA
VCEEMGMALSFDQFSAGWQAIFVGLRTEVITVMNKLREDGHRVVVLSNTNRLHTYFWPGE
YPQIAEAADKIYLSQEMGMRKPEVEIYQKLLETEGFCADQAVFFDDNADNIKGAQQLGIT
SILVTGKDTVPGYFAKGL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatttaggcaacgtcattgttgatatcgacttcaaccgcgtgatg
ggggtatggagcgattacagccgtataccgctagcgaatttgcaaaaaagctttgtgatg
ggggaggctttcaaacgccacgagcgtgggcaaattagtgatgaagagtttgctgaagcg
gtctgtgaagaaatgggcatggcactgagcttcgatcaattttccgccggttggcaggct
atctttgtcgggttacgcacagaagttatcaccgtgatgaacaaacttcgcgaagatgga
catcgcgtcgtggtgctttcaaataccaaccgcttacacacttatttctggccgggtgaa
tatccgcaaattgccgaggcggcagataaaatctatctgtcccaggaaatgggtatgcga
aaacccgaggtagagatttatcaaaaattactcgaaacagaaggtttttgcgcggatcag
gcggtcttttttgacgacaacgccgataatattaaaggagctcaacagttgggtatcacc
agcattttggtgaccggaaaagacacggtgcctggctatttcgcaaaaggcctatga

DBGET integrated database retrieval system