KEGG   Buttiauxella sp. 3AFRM03: D8682_17395Help
Entry
D8682_17395       CDS       T05676                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:buf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    D8682_17395 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:buf03011]
    D8682_17395 (rplV)
Ribosome [BR:buf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    D8682_17395 (rplV)
  Bacteria
    D8682_17395 (rplV)
  Archaea
    D8682_17395 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AYN28598
UniProt: A0A3G2IGP2
Position
3426855..3427187
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALEILTFTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDAGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccacgctcgttcttctgctcaaaaggttcgccttgtt
gcagaccttattcgcggtaagaaagtgtcgcaggcactggaaattttgaccttcaccaac
aagaaagcggctgtattggtcaagaaagttctggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgacgatctgaaagtcgcgaaaatcttcgtagacgcaggccca
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system