KEGG   Buttiauxella sp. 3AFRM03: D8682_18710Help
Entry
D8682_18710       CDS       T05676                                 

Definition
(GenBank) dUMP phosphatase
  KO
K08723  5'-nucleotidase [EC:3.1.3.5]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00230  Purine metabolism
buf00240  Pyrimidine metabolism
buf00760  Nicotinate and nicotinamide metabolism
buf01100  Metabolic pathways
buf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    D8682_18710
   00240 Pyrimidine metabolism
    D8682_18710
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    D8682_18710
Enzymes [BR:buf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     D8682_18710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD NIR_SIR_ferr
Motif
Other DBs
NCBI-ProteinID: AYN28831
UniProt: A0A3G2IHN6
Position
3680704..3681378
Genome map
AA seq 224 aa AA seqDB search
MNWDWILFDADETLFTFDAFGGLQRMFLDYSVTFTAEDFQDYQAVNKPLWVDYQNGAISA
LQLQHQRFLGWSERLSVPAGDLNAAFLNAMAEICVPLPGAVSLLNALKDKVKIGIITNGF
TALQQIRLERTGLRDYFDLLVISEQVGVAKPDRKIFDYTFEQMGHPPRDRVMMVGDTAES
DILGGMNAGIATCWLNAHGRSLPEGISPTWEVTTLNELERLLCN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggactggattttatttgatgctgacgaaacgctgtttacctttgacgcgttc
ggcggcttacagcggatgtttctcgattatagcgtgacgtttaccgctgaagatttccag
gattaccaggctgttaacaaacctttgtgggtcgattatcagaacggtgccattagcgcg
cttcagttacagcatcagcgttttctgggctggtcggaaagattgtcggtgcctgcgggt
gacctgaacgctgcgtttctcaatgctatggccgaaatttgtgtgccgttgcccggtgct
gtttcgctgcttaatgcgttaaaagataaagtaaaaatcggtattatcaccaacggtttt
actgcgctgcagcaaatccgcctggaacgcacgggtctgcgcgattatttcgatttgctg
gtgatttccgaacaggtcggtgtcgcgaaacccgatcgtaagatttttgattacaccttt
gagcaaatgggccatccgccgcgcgaccgcgtcatgatggttggcgacaccgcagaatca
gatattctgggcggcatgaatgcaggaattgccacctgctggctcaacgcccacggacga
agcttaccggaaggcatctcaccgacctgggaagtgaccacactaaatgaactggagcga
ttgttgtgtaattga

DBGET integrated database retrieval system