KEGG   Buttiauxella sp. 3AFRM03: D8682_19150Help
Entry
D8682_19150       CDS       T05676                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
buf  Buttiauxella sp. 3AFRM03
Brite
KEGG Orthology (KO) [BR:buf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    D8682_19150 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AYN28910
UniProt: A0A3G2IHC8
Position
complement(3774486..3774863)
Genome map
AA seq 125 aa AA seqDB search
MLNSPRVCIQVQSVYIESQSSVEHERFVFAYTVTIRNLGRTPVQLLGRYWLITNGNGHET
EVQGEGVIGVQPHIEPGNEYSYTSGAVLETPLGTMQGHYEMVDSQGDAFRVAIPVFRLAI
PAFIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgttaaattcgccccgcgtatgcattcaggtacaaagcgtctatatcgaatcacagtcc
tctgtggagcacgaacgtttcgtctttgcttataccgtaaccatccgtaacctggggcga
acaccggtgcaattacttggccgttactggcttatcaccaatggtaacggtcatgaaact
gaagttcagggcgagggtgtgattggcgtccagccgcatattgaaccgggtaacgaatac
agctatacaagcggtgcggtacttgaaacaccgcttggcaccatgcaaggccattacgaa
atggtcgactctcagggcgatgccttccgcgtcgctattcccgtattccgtttggctatt
ccagccttcattcactaa

DBGET integrated database retrieval system