KEGG   Buttiauxella sp. 3AFRM03: D8682_19300Help
Entry
D8682_19300       CDS       T05676                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00270  Cysteine and methionine metabolism
buf00480  Glutathione metabolism
buf01100  Metabolic pathways
Module
buf_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    D8682_19300
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D8682_19300
Enzymes [BR:buf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     D8682_19300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AYN28939
UniProt: A0A3G2IIF3
Position
complement(3807209..3808156)
Genome map
AA seq 315 aa AA seqDB search
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEAHARTRLVTVE
QNYDKWYEFGSEQDIQLADLDVVLMRKDPPFDTEFIYATYILERAEEQGTLIVNKPQSLR
DCNEKLFTAWFADLTPETLVTRNKAQLKAFWQKHGDIILKPLDGMGGTSIFRVKEGDPNI
GVIAETLTELGNRYCMAQNYLPAIVDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG
RGEPRPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS
ITGMLFDAIEVRLAK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagcttggcatcgtgatggatcccatcgcaaacattaacatcaagaaagactcc
agttttgccatgctgctggaagcccagcgccgtggttacgaactccactatatggaaatg
gccgatctgtatttgatcaacggtgaagcgcatgcgcgcacccgtctggtcactgtcgag
cagaactacgataaatggtacgaatttggcagcgagcaagatattcagcttgccgatctc
gacgtggtgttgatgcgcaaagacccgccgtttgataccgagtttatctacgctacctat
attcttgagcgcgccgaagaacaaggcacgctgatcgttaacaaaccgcagagcctgcgc
gactgtaacgaaaagttgttcaccgcttggtttgctgatttaaccccagaaacacttgtc
actcgcaacaaagcacagttgaaagcattctggcaaaagcatggcgacattatcctcaag
ccgttagatggcatgggcggtacgtcgattttccgcgtcaaagaaggcgaccctaacatt
ggcgttattgctgaaacactaacagagctgggcaatcgttactgcatggcgcaaaactac
ctgccagccattgttgatggcgacaaacgtgttctggttgttgatggtgaacctgttcca
tattgcctggcgcgtattccgcaaggtggtgagactcgtggtaacctggcggctggcggt
cgtggcgaaccacgtccattgactgaaagcgattgggaaattgcccgccgtgtcggccca
acattgaaagccaaaggattgatttttgttggtctggatatcatcggtgaccgcctcact
gagattaatgtcaccagcccaacctgcatccgcgaaatcgaagccgagttccctgtatcg
atcacgggtatgctgttcgacgctatcgaagtacgtctggcgaaatag

DBGET integrated database retrieval system