KEGG   Buttiauxella sp. 3AFRM03: D8682_23385Help
Entry
D8682_23385       CDS       T05676                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00450  Selenocompound metabolism
buf00970  Aminoacyl-tRNA biosynthesis
buf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    D8682_23385
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D8682_23385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:buf01007]
    D8682_23385
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:buf03016]
    D8682_23385
Enzymes [BR:buf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     D8682_23385
Amino acid related enzymes [BR:buf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   D8682_23385
Transfer RNA biogenesis [BR:buf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    D8682_23385
 Prokaryotic type
   Other AARSs
    D8682_23385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AYN29654
UniProt: A0A3G2IJM8
Position
complement(4698423..4700456)
Genome map
AA seq 677 aa AA seqDB search
MAQTAKKLLVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGNTVNFICADDAHGTPIM
LKAQQLGITPEQMIAEMSQEHQTDFAGFNISYDNYHSTHSDENRELASLIYGRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKAPDQYGDNCEVCGATYSPTELIDPKSVVSG
ATPEMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPGAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTESFDEYWKKDSTTELYHFIGKDIVY
FHSLFWPAMLEGSGFRKPTNLFVHGYVMVNGAKMSKSRGTFIKASTWLNHFDADSLRYYY
TAKLSSRIDDIDLNLEDFVQRVNSDIVNKVVNLASRNAGFIAKRFDGQLSAQIADPALYK
TFTDAAQSIGEAWESREFGKAVREIMALADAANRYVDEQAPWVVAKQEGRDADLQAICTM
GINLFRVLMTWLKPVLPTLSERAEAFLNCELSWDGINTPLVNHKVNTFKALYNRIEMKQV
EALVEASKEEVKATTAPVTGPLADDPIAETIAFDDFAKVDLRVALIEKAEFVEGSDKLLR
LSLDLGGEKRNVFSGIRSAYPDPAALEGRLTIMVANLAPRKMRFGISEGMVMAAGPGGKD
IFLLSPDSGAQAGMAVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaccgcgaaaaaattattggtaacgtgcgcacttccgtacgctaacggctca
atccacctcggtcatatgctggagcacattcaggctgatgtctgggtccgttaccaacga
atgcgcggaaacacggtcaacttcatctgcgcagacgatgcccacggcacacctatcatg
ctgaaagcacagcagttaggcattacaccagagcagatgattgccgaaatgagccaggag
catcagactgattttgctggttttaacatcagctatgacaactatcactctacgcatagc
gatgaaaaccgtgagctggcgtcgctgatttatggccgcctgaaagagaacggttttatt
aaaaaccgcaccatttctcagctctacgatccggaaaaaggcatgttcctgccggaccgt
ttcgtcaaaggcacctgcccgaaatgtaaagctccagaccaatacggcgataactgtgaa
gtttgtggcgcaacttatagcccaaccgagcttatcgacccgaaatcggtggtgtctggc
gcaacgcctgaaatgcgtgattccgagcacttcttctttgatttgccatcgtttagcgaa
atgctgcaagcctggacccgaagtggtgcgctgcaagagcaagtggcgaacaaaatgcag
gagtggttcgagtctggcctgcaacagtgggatatctcccgcgatgcgccttatttcggc
ttcgaaattcctggtgcaccgggtaaatatttctacgtctggctggatgcgccaatcggt
tacatgggttcgttcaaaaacctgtgtgacaaacgcggcgataccgaaagcttcgacgaa
tactggaagaaagattccaccaccgagctgtatcacttcatcggtaaagacatcgtttac
ttccacagcctgttctggccagccatgctggaaggcagcggtttccgcaagccgaccaat
ttgtttgtccacggttatgtgatggtcaacggcgcgaagatgtccaaatcgcgcggtacg
ttcattaaagccagcacctggctgaaccatttcgatgccgacagcctgcgttactactac
accgcgaaactgtcctcacgtatcgacgatatcgatctgaatctggaagatttcgtgcag
cgcgtgaatagcgacatcgtcaacaaagtggtcaacctggcttcccgtaacgcaggtttt
attgccaagcgttttgacgggcaactgtctgcacaaatcgctgacccggcgttgtacaaa
accttcaccgatgcggcgcagtcaattggcgaagcgtgggaaagccgcgaattcggtaaa
gccgtgcgtgaaattatggcgctggccgacgccgcaaaccgttatgtcgatgagcaagca
ccatgggtggtagcaaaacaagaaggccgcgatgccgacctacaagccatctgcaccatg
ggcattaacttgttccgcgtgttgatgacctggctgaaaccggttctacctacgctttct
gagcgagctgaagccttcctgaactgtgagctgagctgggatggcatcaacaccccgctg
gtgaaccataaagtgaataccttcaaagcgttgtataaccgcattgagatgaaacaggtt
gaagcgctggttgaagcctcgaaagaagaagtgaaggcgacgacggcaccggtaactggc
ccactggcggatgacccgattgctgaaactatcgcgtttgatgattttgccaaagtggat
ttgcgtgttgcgctgattgagaaagcagaatttgttgaaggttctgacaagctgctgcgt
ctgtcattggatctgggcggcgagaaacgtaacgtgttctcgggtatccgttctgcttat
cctgatcccgccgcacttgaaggccgtttgacgattatggtcgccaacctggcaccgcgt
aaaatgcgcttcggcatctctgaagggatggtgatggcagcaggtcctggcgggaaagat
atcttcctgttaagcccggatagcggcgcacaagcgggtatggctgttaagtaa

DBGET integrated database retrieval system