KEGG   Burkholderia sp. CCGE1001: BC1001_0212Help
Entry
BC1001_0212       CDS       T01424                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00071  Fatty acid degradation
bug00280  Valine, leucine and isoleucine degradation
bug00281  Geraniol degradation
bug00310  Lysine degradation
bug00360  Phenylalanine metabolism
bug00362  Benzoate degradation
bug00380  Tryptophan metabolism
bug00410  beta-Alanine metabolism
bug00627  Aminobenzoate degradation
bug00640  Propanoate metabolism
bug00650  Butanoate metabolism
bug00903  Limonene and pinene degradation
bug00930  Caprolactam degradation
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
bug01130  Biosynthesis of antibiotics
bug01212  Fatty acid metabolism
Module
bug_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BC1001_0212
   00650 Butanoate metabolism
    BC1001_0212
  Lipid metabolism
   00071 Fatty acid degradation
    BC1001_0212
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BC1001_0212
   00310 Lysine degradation
    BC1001_0212
   00360 Phenylalanine metabolism
    BC1001_0212
   00380 Tryptophan metabolism
    BC1001_0212
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BC1001_0212
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BC1001_0212
   00281 Geraniol degradation
    BC1001_0212
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC1001_0212
   00627 Aminobenzoate degradation
    BC1001_0212
   00930 Caprolactam degradation
    BC1001_0212
Enzymes [BR:bug01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BC1001_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADX53677
UniProt: E8YL92
Position
1:241122..241973
Genome map
AA seq 283 aa AA seqDB search
MSQQPHTNDAFYAHYRSLQLHRRPHGVLEVVMSGEGANRSALATADARMHYELAEIWRDI
DRDPDTRVAIIRGEGKGFSAGGDLQLVEDMATDFDVRARVWREARDLVYNVINCSKPIVS
AMHGPAVGAGLVAGLLADISIASKTARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYL
MLCEPVSGAEAERIGLVSLAVDENDLLPKAFEVAQKLAHGSQTAIRWTKYALNNWLRAAG
PAFDTSLALEFMGFAGPDVREGVSSLRERRAPDFGGADPWRAR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcaacctcacaccaacgacgccttttacgcgcattaccgctcgcttcaactg
catcgccgtccgcatggcgtgctcgaagtggtgatgagcggcgagggcgcgaacaggagc
gccctcgcgaccgcggatgcgcgcatgcattacgagctcgcggaaatctggcgcgacatc
gaccgcgatccggacacgcgcgtggcgatcattcgcggcgagggtaagggcttctcagcc
ggcggcgatctgcaactcgtggaagacatggcgaccgatttcgacgtgcgggcgcgcgtg
tggcgcgaggctcgcgatcttgtctacaacgtgatcaattgcagtaagccgatcgtatcg
gccatgcacggtccggcggtcggcgcgggcctcgtcgcggggctgcttgcggacatctcg
atcgcgtcgaaaaccgcgcgcattatcgacgggcatacgcggctcggtgtggccgcaggc
gatcacgcggcgattgtctggccgcttctgtgcggcatggccaaggccaagtattacctg
atgctgtgcgagccggtgagcggcgcggaggcggagcgcatcggcctcgtatcgctcgcc
gtcgacgaaaacgatctgctgccgaaggcatttgaggtcgcgcagaaactcgctcacggt
tcgcaaaccgcgatccgctggaccaagtatgcgttgaacaactggctgcgcgcagcgggc
ccggccttcgatacgtcgctcgcgctcgaattcatgggcttcgccggaccggacgtgcgc
gagggcgtgagttcgttgcgcgagcggcgcgcgccggatttcggcggcgccgacccatgg
cgcgcgcggtga

DBGET integrated database retrieval system