KEGG   Burkholderia sp. CCGE1001: BC1001_0783Help
Entry
BC1001_0783       CDS       T01424                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00010  Glycolysis / Gluconeogenesis
bug00052  Galactose metabolism
bug00500  Starch and sucrose metabolism
bug00520  Amino sugar and nucleotide sugar metabolism
bug00521  Streptomycin biosynthesis
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
bug01130  Biosynthesis of antibiotics
bug01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1001_0783
   00052 Galactose metabolism
    BC1001_0783
   00500 Starch and sucrose metabolism
    BC1001_0783
   00520 Amino sugar and nucleotide sugar metabolism
    BC1001_0783
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BC1001_0783
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BC1001_0783
Enzymes [BR:bug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BC1001_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 ROK LacI
Motif
Other DBs
NCBI-ProteinID: ADX54237
UniProt: E8YFP2
Position
1:complement(872178..874094)
Genome map
AA seq 638 aa AA seqDB search
MSTGVQTKAVPGAGQHADGPRLLADIGGTNARFALETGPGEIGSVQVYPCAEFPGVADVI
RKYLKDTKIGRVNHAAIAIANPVDGDQVSMTNHDWTFSIEATRRALGFDTLLVVNDFTAL
AMALPGLTDAQRVQVGGGARRPNSVIGLLGPGTGMGVSGLIPADDRWIALGSEGGHATFA
PADEREDIVLHYARKKWSHVSFERVAAGPGLEVIYRALAGRDKKRVAANVDTREIVRRAL
DGEPLAAESVDVFCGILGTFAGNIAVTLGALGGIYIGGGVVPRLGDFFARSSFRKRFEAK
GRFEAYLQNVPTYVITAEYPAFLGVSAILAEQLSNRAGGSSSAVFERIRQMRDALTPAER
RVADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIP
VSHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVERAIDLLNGARRIEFYGLGNS
NIVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAM
QAGAKVIAITSSNTPLAKRATVALETDHIEIRESQLSMISRILHLVMIDILAVGVAIRRA
APSADVAEAVAKVRQGADDDATAVLDWLSHGAASSARD
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgtgcaaactaaggctgttccgggcgcgggccagcacgccgacggaccg
aggctgctcgccgacatcggcggcaccaatgcgcgcttcgcgctggaaaccggaccggga
gaaatcggctcggtgcaggtttatccgtgcgcggagttccccggtgttgccgacgtcatt
aggaagtatctgaaggacacgaagatcggccgcgtgaatcatgcggcgattgcgattgcg
aacccggtcgacggcgaccaggtcagcatgacgaatcacgactggaccttctcgatcgaa
gccacgcgccgcgcgctcggcttcgacacgctgctcgtcgtgaacgacttcaccgcgctc
gccatggccctgccgggcctgaccgacgcgcagcgcgtgcaggtcggcggcggcgcgcgc
cgcccgaacagcgtgatcggcctgcttggccccggtacgggcatgggcgtgtcgggtctg
attcccgccgacgaccgctggatcgcgctcggcagcgaaggcggccacgccaccttcgcg
ccggccgacgagcgcgaagacatcgtgctgcactacgcgcgcaagaagtggtcgcacgtg
tcgttcgagcgcgtggccgcgggccccggcctcgaagtgatttaccgcgcgctcgcgggc
cgcgacaagaagcgcgtggcggcgaacgtggatacccgcgagatcgtcagacgcgcgctg
gacggcgagccgctcgccgccgaatccgtcgacgtgttctgcggcattctcggcaccttc
gcgggcaatatcgcggtgacgctcggcgcgctcggcggcatctacattggcggcggcgtg
gtgccgcggctcggcgacttcttcgcgcgctcgtcgtttcgcaagcgcttcgaggcgaag
ggccgcttcgaagcctatctgcagaacgtgccaacctatgtgattaccgcggaatatccc
gcgtttctcggtgtctcggcgattctcgcggagcagttgtcgaaccgcgcgggcggcagt
tcgtcggcggtattcgagcggatccggcagatgcgcgacgcgttgacgccggccgagcgc
cgcgtcgccgatctcgcgctgaaccacccgcgctcgatcatcaacgatccgattgtcgac
atcgcgcgcaaggccgacgtgagtcagccgacggtgatccgcttctgccgttcgctcggt
tgccagggcttgtcggacttcaagctgaagctcgccaccggtttgaccggcacgattccg
gtcagccatagccaggtgcatctcggcgatacggcgaccgatttcggcgcgaaggtgctc
gacaacacggtgtcggcgatcctgcagttgcgcgagcatctgaacttcgagcatgtggag
cgcgccatcgacctgctgaacggcgcgcggcgcatcgagttttacggactcggcaattcg
aacatcgtcgcgcaagacgcgcactacaagttcttccgcttcggcattccgaccattgcc
tacggggacctgtacatgcaggcggcgtcggcggcgctgctcggcaagggcgacgtgatc
gtcgccgtgtcgaagtcgggccgcgcgcccgaactgctgcgcgtgctggatgtggcgatg
caggccggcgcgaaagtgatcgcgatcacgtcgagcaatacaccgttggccaaacgcgcc
acggtcgcgctcgaaaccgatcacatcgaaattcgcgagtcgcagctctcgatgatttcg
cggatcctgcatctcgtgatgatcgacattctcgcggtcggcgtggcaattcgccgcgcg
gcgccgagcgccgacgtcgcggaagccgtggccaaagtgcgtcagggcgccgacgacgac
gccaccgccgtgctcgactggctcagccacggcgcggcttcatcggctcgcgactag

DBGET integrated database retrieval system