KEGG   Burkholderia sp. CCGE1001: BC1001_1082Help
Entry
BC1001_1082       CDS       T01424                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00010  Glycolysis / Gluconeogenesis
bug00051  Fructose and mannose metabolism
bug00562  Inositol phosphate metabolism
bug00710  Carbon fixation in photosynthetic organisms
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
bug01130  Biosynthesis of antibiotics
bug01200  Carbon metabolism
bug01230  Biosynthesis of amino acids
Module
bug_M00002  Glycolysis, core module involving three-carbon compounds
bug_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1001_1082
   00051 Fructose and mannose metabolism
    BC1001_1082
   00562 Inositol phosphate metabolism
    BC1001_1082
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1001_1082
Enzymes [BR:bug01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BC1001_1082
Exosome [BR:bug04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BC1001_1082
  Exosomal proteins of bladder cancer cells
   BC1001_1082
  Exosomal proteins of melanoma cells
   BC1001_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADX54527
UniProt: E8YI60
Position
1:1215083..1215862
Genome map
AA seq 259 aa AA seqDB search
MSTQRAKLVVGNWKMHGRLAENAGLLQAVAKGAGELPVAVRVGVCVPSPYLAQAQSLLEG
SRVVWGVQDVSAFTHGAYTGEVAAQMVTDFGATFAIVGHSERRAYHRESAELVAVKTQRA
LEAGLTPIVCVGETLEEREAGATEQVVGAQLDEVLAKLSAQEAARIVVAYEPVWAIGTGK
SASSEQAQAVHAFLRARLAVKGAEVAGVPLLYGGSVKPDNAEELFRQQDIDGGLIGGASL
KDQDFLAICKAAAATAAAS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacaacgagccaaactggtagtgggtaactggaagatgcatgggcgcctcgcc
gagaacgccgggctgctgcaggccgtggcaaaaggcgcgggcgaactgccggttgcggtg
cgcgtaggtgtgtgcgtgccgagcccatatctcgcgcaagcgcagtcgttgctcgaaggc
agccgggtggtgtggggtgtgcaggatgtttccgcttttacgcacggtgcctataccggc
gaagttgctgcgcaaatggtgacggatttcggtgccacgtttgcaatcgtcgggcactcg
gagcggcgtgcctatcaccgcgagagcgcggagctcgtcgcggtcaagacgcagcgtgcg
ctcgaggcgggcttgacgccgatcgtgtgtgtcggcgaaacgctggaagagcgggaagcg
ggcgcgacggagcaggtggtcggcgcgcagctggacgaagtgctggcgaaactgtcggcg
caagaagcggcgcgtatcgtcgtcgcctatgagcccgtctgggctatcggcaccggcaag
agtgcgagttcggagcaggcgcaggcggtccatgcgtttctgcgcgcgcgtcttgcggta
aagggtgctgaggtcgcgggcgtgccgctgttgtatggcggcagcgtgaagcccgacaat
gcggaagagttgttccgtcagcaggatatcgacggcggtctgatcggcggcgcgtcattg
aaggaccaggattttctggcgatctgcaaagcggcggctgcaacggcagccgcgagttga

DBGET integrated database retrieval system