KEGG   Burkholderia sp. CCGE1001: BC1001_1423Help
Entry
BC1001_1423       CDS       T01424                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00071  Fatty acid degradation
bug00072  Synthesis and degradation of ketone bodies
bug00280  Valine, leucine and isoleucine degradation
bug00310  Lysine degradation
bug00362  Benzoate degradation
bug00380  Tryptophan metabolism
bug00620  Pyruvate metabolism
bug00630  Glyoxylate and dicarboxylate metabolism
bug00640  Propanoate metabolism
bug00650  Butanoate metabolism
bug00900  Terpenoid backbone biosynthesis
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
bug01130  Biosynthesis of antibiotics
bug01200  Carbon metabolism
bug01212  Fatty acid metabolism
bug02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1001_1423
   00630 Glyoxylate and dicarboxylate metabolism
    BC1001_1423
   00640 Propanoate metabolism
    BC1001_1423
   00650 Butanoate metabolism
    BC1001_1423
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BC1001_1423
   00072 Synthesis and degradation of ketone bodies
    BC1001_1423
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BC1001_1423
   00310 Lysine degradation
    BC1001_1423
   00380 Tryptophan metabolism
    BC1001_1423
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BC1001_1423
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC1001_1423
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BC1001_1423
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bug04147]
    BC1001_1423
Enzymes [BR:bug01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BC1001_1423
Exosome [BR:bug04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1001_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADX54859
UniProt: E8YLH5
Position
1:complement(1624756..1626057)
Genome map
AA seq 433 aa AA seqDB search
MPHPLPPVRRVAILGGNRIPFARSNTAYATASNQDMLTFTLQGLIDRYELHGERLGEVAA
GAVIKHSRDFNLTRESVLSTTLAKETPAYDVQQACGTGLEATILVANKIALGQIDVGIAG
GVDTTSDAPIGVNENMRKILLEANRGRSAGQRVGALAKLRPGMFFKPLLPRNGEPRTGLS
MGEHCELMAKRWNISREAQDVLAYDSHRKLGQAYARGFLNDLMTPYRGLARDNNLRTDLT
LDKLASLKPAFDRDAGTLTAGNSTPLTDGASAVLLASEDWAARRGLPVLAYLSWSETAAV
DFFDKKEGLLMAPAYAVARMLARAGLTLQEFDFYEIHEAFAAQVLCTLAAWQDDEYCRTQ
LGLDAPLGAIDRAKLNVNGGSLATGHPFAATGARIVAGLAKLLAQLDAPAGSARGLISIC
AAGGQGVVAILER
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacccgctgccacccgtgcgccgcgtcgcgattctcggcggcaaccggattccg
ttcgcccgctcgaacacggcctatgcgaccgcgtcgaatcaggacatgctgacttttacg
ctgcaagggctgatcgaccgctatgagctgcacggcgaacgcctcggcgaagtggcggcg
ggcgcggtcatcaagcattcgcgcgacttcaatctgacgcgcgaatccgtgctgtccacc
acattggcgaaggaaacacccgcgtacgatgtgcaacaggcctgcggcaccggcctcgaa
gcgacgatactcgtcgccaacaagattgcgttgggacagatcgacgtgggcatcgcgggc
ggtgtggatacgacatcggatgcgcctatcggcgtgaacgaaaacatgcgcaagattctg
ctcgaagcgaatcgcggcaggagtgcgggccagcgcgtcggcgcgctcgcgaagctgcgg
cccggcatgttcttcaagccgctgttgccgcgcaacggcgagccgcgcaccggtctttcg
atgggcgagcactgcgagctgatggcgaaacgctggaacatttcgcgcgaagcccaggac
gtgctcgcctacgacagccaccgcaagctcggccaagcgtatgcgcgcggctttctcaac
gatctgatgacgccgtaccgcggcctcgcgcgcgacaacaatctgcgcaccgacctgacg
ctcgacaagctcgcctcgctcaagcccgccttcgaccgcgacgccggcacgctgaccgcc
ggcaattccacgccgctcaccgacggcgcgtccgccgtgctgctcgcgagcgaagactgg
gccgcgcgccgcggcttgccggtgctcgcgtacctgagctggtcggaaaccgcggccgtc
gacttcttcgacaagaaagaaggcctcttgatggcgccggcctacgcggtggcgcgcatg
ctcgcgcgagccggactgacgttgcaggaattcgatttctacgagatccacgaagcgttc
gcggcgcaggtgttgtgcacgctcgcggcctggcaggacgacgaatattgccgcacgcag
ttgggcctcgacgccccgctcggcgcgatcgaccgcgcgaaactcaacgtgaacggcggc
tcgctcgcgacgggccatccgttcgccgcgacgggcgcacgcatcgtcgccggtctcgcg
aagctgcttgcgcagctcgacgcaccggcgggcagcgcgcgcggactgatttcgatttgc
gcggcgggcggccagggcgtggtggcgattctggagcgctga

DBGET integrated database retrieval system