KEGG   Burkholderia sp. CCGE1001: BC1001_2151Help
Entry
BC1001_2151       CDS       T01424                                 

Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00540  Lipopolysaccharide biosynthesis
bug01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BC1001_2151
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bug01003]
    BC1001_2151
   01005 Lipopolysaccharide biosynthesis proteins [BR:bug01005]
    BC1001_2151
Enzymes [BR:bug01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     BC1001_2151
Glycosyltransferases [BR:bug01003]
 Polysaccharide
  Bacterial polysaccharide
   BC1001_2151
Lipopolysaccharide biosynthesis proteins [BR:bug01005]
 Lipid A
  BC1001_2151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB Epimerase_2
Motif
Other DBs
NCBI-ProteinID: ADX55568
UniProt: E8YHL2
Position
1:complement(2438045..2439214)
Genome map
AA seq 389 aa AA seqDB search
MALQPSPLRIAMVAGEPSGDLLASSLLGGLASRLPAAAHYYGIGGPRMIATGFDAHWPME
KLSVRGYVEALRHIPEILRIRNDLKRQLLAEPPAVFVGVDAPDFNFGLEHPLREAGIPTV
HFVCPSIWAWRGGRIKKIAKAVDHMLCVFPFETALLEKAGVAASYVGHPLADEIPLEPDT
LGARRTLGLAESGPVIAVLPGSRRSEIDLIGPTFFAAMEMMQHQEPRLRFVMPAATPALR
EMLRPLVDSHPGLALTITDGQSQLAMTAADAILVKSGTVTLEAALLKKPMVISYKVPWLT
GQIMRRQGYLPYVGLPNILAGRFVVPEILQHFATPQALAEATLKQLRDEANRRTLTEIFT
EMHHVLKQNTAQRAAEVVASIVERRGARP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcattgcaacccagtccgctgcgcatcgccatggtggccggcgagccgtccggcgac
ctgctggcctcgtcgctgctgggcggcctcgcgagccgcttgcctgccgccgcgcattac
tacggcattggcggcccgcgcatgatcgccacgggtttcgacgcccattggccgatggaa
aaactgtccgtgcgcggctatgtcgaagcgctgcggcacattcccgaaattctgcgcatc
cgcaacgacctgaagcgccagttgctggctgagccgccagcagtgttcgtcggcgtggat
gcgcccgatttcaacttcgggctcgagcatccgctgcgcgaggcgggcattccgaccgtc
cacttcgtgtgcccgtccatctgggcgtggcgcggcgggcgcatcaagaagatcgccaag
gcggtcgaccacatgctgtgcgtgtttccgttcgaaaccgcgctgctggaaaaggcgggc
gttgccgcgtcgtatgtgggccatccgcttgccgacgagatcccgctcgaaccggacacg
ctcggcgcgcgccgcacgctgggtctcgcggaaagcggtccggtcatcgcggtgctgccc
ggcagccgccgctcggagatcgacctgatcgggccgacgttttttgccgcgatggaaatg
atgcagcaccaggagccccgcctgcgcttcgtgatgccggcggccacgcccgctttgcgc
gagatgctgcgcccgctggtcgattcgcacccggggcttgcgctcaccattacggacggc
cagtcgcaactcgccatgaccgcggccgacgcgatcctcgtgaaaagcggcacggtcacg
ctcgaggctgcgcttctgaaaaagccgatggtgatctcctacaaggtgccctggctgacc
ggtcagatcatgcgccggcagggctatctgccgtacgtgggcttgccgaacattctggcc
gggcgcttcgtcgtgccggaaatcctgcagcatttcgcgacgcctcaggcgctcgccgag
gccacgctgaaacagttgcgcgacgaagccaaccggcgcacgctgacggaaatcttcacg
gagatgcatcacgtgctgaagcagaataccgcgcagcgtgcggcggaggttgtcgcgagc
atcgtcgaaaggcgtggggcgcggccgtga

DBGET integrated database retrieval system