KEGG   Burkholderia sp. CCGE1001: BC1001_2181Help
Entry
BC1001_2181       CDS       T01424                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00480  Glutathione metabolism
bug00590  Arachidonic acid metabolism
bug01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BC1001_2181
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BC1001_2181
Enzymes [BR:bug01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BC1001_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADX55598
UniProt: E8YHP2
Position
1:complement(2474469..2474948)
Genome map
AA seq 159 aa AA seqDB search
MTSIYSFSARTLGGEEVSLAQYEGKVLLIVNTASECGFTPQYAGLQKLYDSYAARGLAVL
GFPCNQFGKQEPGDAAQIGSFCEKNYGVTFPMFDKVDVNGANAHPLFRYLTGEAPGLLGL
EAIKWNFTKFLIGRDGNVVKRYAPLTKPEAITEDIEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgatttattctttttcggcccgcacgctgggcggcgaggaagtgagtctcgcg
cagtacgagggcaaggtgctgctgatcgtcaacacggcgagcgaatgcgggttcacgccg
cagtacgcgggcttgcagaagctctacgacagctacgcggcgcgcgggctcgcggtgctc
ggctttccgtgcaaccagttcggcaagcaggaaccgggcgacgccgcgcagatcggcagc
ttttgcgagaagaactacggcgtgaccttcccgatgttcgacaaggtggacgtgaacggc
gcgaacgcgcatccgctgttccgttatctgacgggcgaggcgccgggccttctcggcctc
gaagcaatcaagtggaatttcacgaagtttctgatcggccgcgacggcaacgtggtcaag
cgctatgcgccgctgaccaaaccggaggcgatcacggaggacatcgaaaagctgctgtga

DBGET integrated database retrieval system