KEGG   Burkholderia sp. CCGE1001: BC1001_2203Help
Entry
BC1001_2203       CDS       T01424                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00860  Porphyrin and chlorophyll metabolism
bug00970  Aminoacyl-tRNA biosynthesis
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BC1001_2203
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BC1001_2203
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bug01007]
    BC1001_2203
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bug03016]
    BC1001_2203
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bug02048]
    BC1001_2203
Enzymes [BR:bug01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BC1001_2203
Amino acid related enzymes [BR:bug01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BC1001_2203
Transfer RNA biogenesis [BR:bug03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BC1001_2203
 Prokaryotic Type
   Other AARSs
    BC1001_2203
Prokaryotic defense system [BR:bug02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BC1001_2203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ADX55620
UniProt: E8YHR4
Position
1:complement(2498872..2500281)
Genome map
AA seq 469 aa AA seqDB search
MTTSVRTRFAPSPTGFIHLGNIRSALYPWAFARKMKGTFVLRIEDTDVERSTTESVDAIL
EGMEWLGLDFDEGPFYQMQRMDRYREVLQQMRDAGLVYPCYMSTEELDALRERQREAGEK
PRYDGTWRPEPGKVLPEPPAGVQPVLRFRNPLTGMVAWDDAVKGRIEISNEELDDLVIAR
PDGTPTYNFCVVVDDLDMRITHVIRGDDHVNNTPRQINILRALGGEPPVYAHLPTVLNEQ
GEKMSKRHGAMSVMGYRDAGYLPEAVVNYLARLGWSHGDAEIFSREQFVEWFDLEHLGKS
PAQYDHDKLNWLNAHYIKEADNARLAGLARPFLAELGIDEAAIAQGADLSAVVGLLKDRA
STVKEIAESAAMFYRTPAPDAEALAQHVTDAVRPALGELAAALKTVEWTKEAIAAALKAT
LSAHKLKMPQLAMPVRLLVAGTTHTPSIDTVLMLFGRDVVVSRIEKALA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctccgttcgcacccgtttcgcaccgagtcccaccggcttcattcacctcggc
aacatccgctccgcgctttatccgtgggcgttcgcgcgcaagatgaaagggaccttcgta
ctgcggatcgaggacaccgacgtcgagcgttccaccactgaatccgtcgacgccatcctg
gaaggcatggaatggctcggcctcgatttcgacgaaggcccgttctaccagatgcagcgc
atggaccgctaccgcgaagtgcttcagcagatgcgcgacgcggggctcgtgtatccgtgc
tacatgtcgaccgaagaactcgacgcgctgcgcgagcgccagcgcgaggccggcgaaaaa
ccgcgctacgacggcacgtggcgtcccgagccgggcaaggtgttgcccgagccgccggcg
ggcgtgcagcccgtgctgcgcttccgtaatccgctcaccggcatggtggcctgggacgac
gcggtgaaagggcgcatcgaaatctcgaacgaggagctggacgacctcgtgatcgcgcgg
ccggacggcacgccgacctacaacttctgtgtggtggtggacgatctggacatgcgcatc
acgcacgtgattcgcggcgacgatcacgtgaacaacacgccgcggcagatcaatattctg
cgcgcactcggcggcgagccgccggtgtacgcgcacttgccgaccgtgctcaacgagcag
ggcgaaaagatgagcaagcgtcacggcgcgatgagcgtaatgggttatcgcgacgccggc
tacctgcccgaggccgtggtgaactatctcgcgcgcctcggctggtcgcatggcgacgcg
gagattttctcgcgtgagcagtttgtcgaatggttcgatctggaacatctcggcaagtca
ccggcgcagtacgaccacgacaagctcaactggctcaacgcgcattacatcaaggaagcg
gacaacgcgcgccttgccggcctcgcgcggccgttcctcgccgaactgggtatcgacgag
gcggccatcgcgcaaggcgccgacctgagcgccgtggtgggcttgctgaaggaccgcgcg
tccacggtcaaggagattgcagagagcgcggcgatgttctatcgcacgcccgccccggat
gcggaagccctcgcgcaacatgtgaccgacgcagtgcgcccggcgctcggcgagctggct
gccgcgttgaagaccgtcgagtggaccaaggaggcgatcgccgccgcgctcaaggccacg
ctttccgcgcacaagctgaagatgccgcaactcgccatgccggttcgtctgctggtggcg
ggcaccacgcatacgccgtctatcgatacggtgctgatgctgttcggccgcgatgtggtg
gtgagccgtatcgagaaagcgctggcataa

DBGET integrated database retrieval system