KEGG   Burkholderia sp. CCGE1001: BC1001_2711Help
Entry
BC1001_2711       CDS       T01424                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00230  Purine metabolism
bug01100  Metabolic pathways
Module
bug_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BC1001_2711
Enzymes [BR:bug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BC1001_2711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 RsgA_GTPase ABC_tran AAA_16 AAA_18 AAA_29 AAA_22 AAA_23 Septin AAA_25 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ADX56127
UniProt: E8YME9
Position
1:complement(3090741..3091424)
Genome map
AA seq 227 aa AA seqDB search
MTDHHTRESGAPRNPYAGAYPGNLFMVVAPSGAGKSTLVNALLAGDDAIRLSISYTTRPP
RPKEQDGEHYHFTTVDDFMRRHDAGEFLESAEVHGNYYGTSRVWIEEQMKSGHDVLLEID
WQGAQQVKKQFHNAVEIFILPPSLEALEERLKKRGQDEPNVITRRLLAAGSEMAHAAEAE
YVVINENFDRALGELQCLVAATRSRFASQYARHTQLFVQLGIHLPHP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcatcacacacgcgaaagcggcgcaccgcgcaacccgtatgccggcgcctat
cccggcaacctgttcatggtcgtcgcgccttcgggcgccggcaagtcgacgctcgtgaac
gcgctgctcgccggcgacgacgcgatccgtctgtcgatctcgtacacgacgcgtccgccg
cgtccgaaggagcaggacggcgagcactatcacttcacgacggtcgacgacttcatgcgg
cggcacgacgcgggcgagttcctcgaaagcgcggaagtgcacggcaactactacggcacg
tcgcgcgtgtggatcgaggagcagatgaaaagcggccatgacgtgctgctcgaaatcgac
tggcaaggcgcgcagcaggtgaagaagcagttccacaacgcggtcgaaatcttcatcttg
ccgccgtcgctcgaagcgctcgaagagcgtctgaaaaagcgcggccaggacgagccgaac
gtcatcacgcgacgcctgctcgcggccggcagcgagatggcgcacgcagccgaagcggag
tacgtggtgatcaacgagaacttcgatcgcgcgctcggcgaactgcagtgcctcgtggcg
gcaacgcgctcgcgcttcgcctcgcaatacgcgcgtcatacgcagcttttcgtgcagctc
ggcattcacctcccgcacccctga

DBGET integrated database retrieval system