KEGG   Burkholderia sp. CCGE1001: BC1001_2940Help
Entry
BC1001_2940       CDS       T01424                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00020  Citrate cycle (TCA cycle)
bug00640  Propanoate metabolism
bug00660  C5-Branched dibasic acid metabolism
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
bug01130  Biosynthesis of antibiotics
bug01200  Carbon metabolism
Module
bug_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bug_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC1001_2940
   00640 Propanoate metabolism
    BC1001_2940
   00660 C5-Branched dibasic acid metabolism
    BC1001_2940
Enzymes [BR:bug01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BC1001_2940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp Cation_ATPase_N
Motif
Other DBs
NCBI-ProteinID: ADX56354
UniProt: E8YPB6
Position
1:complement(3347386..3348555)
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPVFSVDDAVKAAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSLEQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADIKKELYVGLVIDRVSQK
IVVMASSEGGMDVEEVAEKTPELIHKVAVDPSTGLKDAEADDLAKKIGVPDASIPQARAI
LQGLYKAFWETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKIMLKNPNLTAILVNIFGGIMRCDVIAEGVIAASKAVSLKVPLVVRMKGTNEDLGKKM
LAESGLPIISADSMEEAAQKVVAAAAGKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggcgtcgcggtaccg
cgcggcaagccggtcttctcggtggatgatgcggtcaaggccgcggaagagctcggcggc
ccggtgtgggtcgtgaaggctcagatccatgcgggtggccgtggtaagggcggcggtgtg
aaggttgccaagtcgctggagcaggtccgcgaatacgcgaaccagatcctcggcatgcag
ctcgtcacgcaccagaccggtccggaaggccagaaggtcaatcgtctgctgatcgaagaa
ggcgccgacatcaagaaggaactgtatgtcggcctcgtgatcgatcgcgtttcgcagaag
atcgtcgtgatggcatcgagcgaaggcggcatggacgtcgaagaagtcgcggaaaagacg
cccgagctgatccataaggttgccgtcgacccgtcgaccggcctgaaggacgccgaagca
gacgacctcgcgaagaagatcggcgtgcccgacgcgtcgatccctcaagcgcgcgcgatc
ctgcaaggcctctacaaggcattctgggaaaccgacgcatcgctcgccgaaatcaacccg
ctgattctgacgggcgacggcaaggtcatcgcgctcgacgccaagttcaacttcgactcg
aacgcgctgttccgtcatccggaaatcgtcgcgtatcgcgatctggacgaagaagatccg
gctgaagtggaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgtctggtgaacggcgcgggcctcgccatggcgaccatggacaccatcaagctgttcggc
ggcgaaccggcaaacttcctcgacgtgggcggcggcgccacgacggagaaggtcacggaa
gccttcaagatcatgctgaaaaacccgaacctgaccgcgattctggtcaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgcggcgtcgaaggccgtgtcg
ctgaaggtgccgctcgtggtccgcatgaagggcaccaacgaagacctgggcaagaagatg
cttgctgaatccggcctgccgatcatctcggcggacagcatggaagaagcggctcagaag
gtcgtcgcggctgctgcgggcaaggcgtaa

DBGET integrated database retrieval system