KEGG   Burkholderia sp. CCGE1001: BC1001_3132Help
Entry
BC1001_3132       CDS       T01424                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
bug  Burkholderia sp. CCGE1001
Brite
KEGG Orthology (KO) [BR:bug00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BC1001_3132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ADX56546
UniProt: E8YG06
Position
1:complement(3571578..3571952)
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSVSAQVQFLPEESDPERRQYAFAYTLTIRNTGQVPAQLIARHWVITDSEKTVQE
VKGLGVVGHQPLLKPGEQFEYTSWAVIATPVGTMRGEYFCVAEDGERFDAPVPEFILRMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtacgaattcagcgtgtcggcgcaggtgcagtttctgcccgaggagtcggac
ccggagcgccgccagtatgcgttcgcctatacgctgaccatccgcaataccggtcaggtg
cccgcgcaactgatcgcacggcattgggtgatcacagacagtgaaaagacggtgcaggaa
gtgaagggtctcggcgtggttggccaccagccgctcctcaaacccggcgagcagttcgaa
tacacgagctgggcggtcatcgccacgccggtcggcacgatgcgaggagagtacttctgc
gtggctgaggacggtgagcgtttcgacgcgccggtgccggagttcattctgcgcatgccg
cgcacgctgcattga

DBGET integrated database retrieval system