KEGG   Burkholderia sp. CCGE1001: BC1001_3276Help
Entry
BC1001_3276       CDS       T01424                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bug00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BC1001_3276
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bug03011]
    BC1001_3276
Ribosome [BR:bug03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BC1001_3276
  Bacteria
    BC1001_3276
  Archaea
    BC1001_3276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADX56690
UniProt: E8YH96
Position
1:complement(3706255..3706584)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKITSIYIDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaaaacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggctgcgggaatcgtgaaaaaggtcgtgctgtcggcgatcgcgaatgcggagcac
aacgaaggcgccgatatcgatgagctcaagattacgagcatctacatcgacaaggctgcg
tcgctcaagcgtttcaccgcgcgcgctaaaggccgcggtaaccgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system