KEGG   Burkholderia sp. CCGE1001: BC1001_3775Help
Entry
BC1001_3775       CDS       T01424                                 

Definition
(GenBank) Glutaminase, core
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00220  Arginine biosynthesis
bug00250  Alanine, aspartate and glutamate metabolism
bug00471  D-Glutamine and D-glutamate metabolism
bug01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BC1001_3775
   00220 Arginine biosynthesis
    BC1001_3775
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BC1001_3775
Enzymes [BR:bug01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BC1001_3775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ADX57186
UniProt: E8YR95
Position
2:202694..203608
Genome map
AA seq 304 aa AA seqDB search
MNYASILEQIHRDLRPYLGTGKVADYIPQLAKVPADSFGMAIVTASGEVFRIGEADTRFS
IQSISKLFACTMAFRLLGDALWQRVGREPSGNAFNSLVQLEAEHGKPRNPFINAGALIVT
DVLCRRFVQAETALVEFMRRLTGETSIDYDSRVAQSELQHAHRNRAMAHFMASFGNMEMP
PEVVVDAYCRQCAISMSCVELAKAALFLTNHGVVPATGERILDTSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWSPGLDANGNSLAGVLALEWLTTYTG
KSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatccattctcgaacagattcatcgcgacttgcggccttatctgggcacc
ggcaaggtcgcggattacattccgcaactggcaaaagtccccgccgacagcttcggcatg
gcgatcgtcacggcatcgggcgaagtattccggatcggcgaagccgacacgcgtttttcc
attcagagtatttccaagctattcgcctgcaccatggcgttccgcctgctcggcgacgcg
ctgtggcaacgtgtcggccgcgagccgtcgggcaatgctttcaattcgctggtgcaactc
gaggcggagcacggcaagccgcgtaatcccttcatcaatgcaggggcactgatcgtcacc
gatgtactgtgccggcgtttcgtgcaagccgaaaccgctcttgtcgaattcatgcgacgc
ttaacaggcgagaccagcatcgactacgactcgcgcgtcgctcaatcggaattgcagcac
gcgcatcgcaaccgcgcgatggcgcatttcatggcgagcttcggcaacatggaaatgccg
ccagaagtcgtggtcgacgcgtattgccggcaatgcgcaatctccatgagttgcgtcgag
ctggccaaagccgcactctttctcacgaatcacggggtggtgcccgccactggcgagcga
attctcgatacgagttccgcgaagcgcctctcggcactcatgctgacctgcggcacgtac
gacgccgccggcgacttcgtttaccgcgtcggcttgcccgcgaagagcggcgtgggcggc
ggcatcgtcgcggtgctgcccggagaaatggcggtgtgcgtctggtcacctgggctcgac
gccaatggcaattcactagccggcgtgctcgcactcgaatggctgacgacttatacggga
aagtcaattttctga

DBGET integrated database retrieval system