KEGG   Burkholderia sp. CCGE1001: BC1001_4712Help
Entry
BC1001_4712       CDS       T01424                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00562  Inositol phosphate metabolism
bug00564  Glycerophospholipid metabolism
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BC1001_4712
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BC1001_4712
   00565 Ether lipid metabolism
    BC1001_4712
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BC1001_4712
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bug02042]
    BC1001_4712
Enzymes [BR:bug01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BC1001_4712
Bacterial toxins [BR:bug02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BC1001_4712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: ADX58099
UniProt: E8YWI6
Position
2:1248863..1251025
Genome map
AA seq 720 aa AA seqDB search
MTSNSRRRFLQTVASSAGAAAALTALPESIRNALAVPAFSRTGTIRDVEHIVVFMQENRS
FDHYFGHLRGVRGYNDRFPIPLPNGKPVWYQPSKADPTKPVLPFHLNTSTTSAQCVGDLD
HSWYKTHAAIDGGRYDQWPATKTDMTMGYHLRSDIPFHYALADAFTICDAYFCSLPGPTH
PNRSYLMTGTVDPTGKFGGPLLDNNDWVDGDGPPNYQLLSWTTYPERLQAAGISWQIYQQ
GLTGADPLNGNYGTNILQNFSNFINAQPGSPLYERAQTVRTIDDLKADVLANRLPQVSWL
CPPAAYSEHPQYTPAYGAEYTSQILDALTSNPEVWSKTVLFIMYDENDGFFDHMVPPQPA
TTAAQGKSTVSTEGEIHNVVNPARGGSYTADGLPYGLGPRVPMTIVSPWSKGGFVCSQVF
DHTSVIRFIETRFGVYEPNITAWRRAVCGDLTTAFDFRTPDSRIPPLPDTSNYKSIADNQ
CATQPKPTVPATPGAIDPQESGIRFARALPYELHVNGHADPKQNTFEISFANTGDQGAHF
YVYSTNRTDGPWRYTVEAGKSLGESFDLTATNSVYAFEVFGPNGFVRKFAGNTQAATQPA
AQAAQLAGGHHHDKAPQPEVKVQYDVANGNVFLKFSNKGGGLARLTVTDNAYGARPRPVI
VPAGAHIEEAWVLASSHHWYDLTVTSNDDDSFSRRVAGHVENGRPSISDPAAIAPVLVVN
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaatagccgtcgccgtttcctgcagaccgtggcttcatccgccggcgctgcc
gccgcgctgaccgcgctgcccgagtcgattcgcaatgcgctggccgttcccgcgttctcg
cgcacgggcaccattcgcgacgtcgagcacattgtcgtgttcatgcaggagaaccgctcg
ttcgaccactacttcggccatctgcgcggcgtgcgtggctacaacgaccgcttcccgatc
ccgctgccgaacggcaagccggtgtggtatcaaccgtcgaaggcagatcccaccaagccg
gtgctgccgttccatctgaatacgtcgaccaccagcgcgcaatgcgtgggcgacctggac
cacagctggtacaagacgcatgccgctatcgacggcggccgctacgatcagtggccggcc
accaagacggacatgacgatgggctatcacctgcgcagcgacattccgtttcactacgcg
cttgccgacgccttcacgatctgcgatgcgtatttctgctcgctgccgggaccgacgcac
ccgaaccgctcgtatctgatgaccggcaccgtggacccgaccggcaagttcggcggaccg
ctgctcgacaacaacgattgggtggacggcgacggcccgccgaactatcagttgctgtca
tggaccacctaccccgagcgcctgcaggccgccggcatttcgtggcagatctaccagcaa
ggtttgaccggcgccgatccgctgaacggcaactacggcacgaacatcctgcagaacttc
agcaacttcatcaacgcccagcccggctcgccgttgtatgagcgcgcgcaaaccgtgcgc
accatcgacgacctgaaggccgacgtgctcgcgaacaggctaccgcaggtgtcctggctg
tgcccgcccgccgcgtactcggagcatccgcaatacacgcccgcgtacggcgccgaatat
acgtcgcagattctcgacgcgttgacctcgaaccccgaggtgtggagcaagaccgtgctc
ttcatcatgtacgacgagaacgacggcttcttcgaccacatggtgccgccgcagccggcc
accacggctgcgcaaggcaagtcgacggtcagcacggaaggcgaaattcacaacgtggtc
aacccggcgcgcggtggcagctataccgccgacggcctgccctacggcctcggcccgcgc
gtgccgatgaccatcgtctcgccgtggagcaaaggcggcttcgtgtgctcgcaggtgttc
gaccacacgtcggtgatccgcttcatcgaaacgcgctttggcgtgtatgagccgaacatc
accgcctggcgtcgcgccgtgtgcggcgatctcaccacggcgttcgatttccgcacgccg
gattcgcgcatcccgccgctgccggacacgagcaactacaagagcatcgccgacaaccag
tgcgcgacgcagcccaagccgacggtgcccgcgacgcccggcgcaatcgatccgcaggaa
agcggcattcgtttcgctcgcgctttgccgtatgaattgcacgtgaacggccacgcggac
ccgaagcagaacacgttcgagatctcgttcgccaacaccggcgaccagggcgcgcacttc
tatgtgtactcgacgaatcgcacggacggtccgtggcgctataccgtggaagctggcaag
tcgctcggcgaatcgttcgatctgacggcgaccaacagcgtgtacgcgttcgaagtcttc
gggccgaacggctttgtgcgcaaattcgcgggcaacacgcaggcagcgacgcaacctgcg
gcgcaggccgcgcagcttgccggcggccatcaccacgacaaagcgccgcagcctgaggtc
aaggtgcaatacgacgtcgcgaacggcaacgtgttcctcaagttcagcaacaagggtggc
ggcctcgcgcgcttgacggtgaccgacaacgcgtatggcgcccgcccgcgcccggtgatc
gtgccggcgggcgcgcatatcgaggaggcatgggtgctggcgtcgagccatcactggtac
gacctgacggtgacgagcaacgacgacgacagcttctcgcgtcgcgtggcgggtcacgtc
gaaaacggccgcccgagcatcagcgacccggctgctattgcgccggtgctggtggtgaac
tga

DBGET integrated database retrieval system