KEGG   Burkholderia sp. CCGE1001: BC1001_4977Help
Entry
BC1001_4977       CDS       T01424                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00020  Citrate cycle (TCA cycle)
bug00190  Oxidative phosphorylation
bug00650  Butanoate metabolism
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
bug01130  Biosynthesis of antibiotics
bug01200  Carbon metabolism
Module
bug_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bug_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bug_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC1001_4977
   00650 Butanoate metabolism
    BC1001_4977
  Energy metabolism
   00190 Oxidative phosphorylation
    BC1001_4977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ADX58358
UniProt: E8YQV3
Position
2:complement(1555176..1555544)
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRITACVMALYTVILLAWFFGARDFSYEGWASIFA
TQWMKLATFVTLLSLFYHAWVGIRDIWMDYVKPVGVRLLLQALTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaataaccgaatcggctcgaagcgtctggtggtgggcgcgcactacggtctg
cgcgactggctcgcgcagcgcatcaccgcctgcgtgatggccctctacacggtgatcctg
ctcgcgtggttcttcggcgcgcgcgacttctcctacgaaggctgggcctcgatcttcgcc
acccagtggatgaagctcgccaccttcgtcacgctgctctcgctcttctatcacgcgtgg
gtcggcatccgcgacatctggatggactatgtgaagcccgtgggcgtgcgtctgctgctg
caggcgctgaccatcgtctggctgctcgcgtgcgcgggctacgctgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system