KEGG   Burkholderia sp. CCGE1001: BC1001_5006Help
Entry
BC1001_5006       CDS       T01424                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00010  Glycolysis / Gluconeogenesis
bug00071  Fatty acid degradation
bug00350  Tyrosine metabolism
bug00625  Chloroalkane and chloroalkene degradation
bug00626  Naphthalene degradation
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
bug01130  Biosynthesis of antibiotics
bug01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1001_5006
  Lipid metabolism
   00071 Fatty acid degradation
    BC1001_5006
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC1001_5006
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC1001_5006
   00626 Naphthalene degradation
    BC1001_5006
Enzymes [BR:bug01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BC1001_5006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C adh_short
Motif
Other DBs
NCBI-ProteinID: ADX58387
UniProt: E8YRS2
Position
2:complement(1580720..1581745)
Genome map
AA seq 341 aa AA seqDB search
MTQMMKAAVVREFGAPLQIEEVPVPRPGRGQVLVNVKASGVCHTDLHAADGDWPVKPALP
FIPGHEGVGDVAAVGEGVTHIREGDRVGVPWLYTACGHCEHCLGGWETLCHEQQNTGYSV
NGAYAEYVLADPNYVGHLPASVSFEAIAPILCAGVTVYKGIRVTDTRPGQWITISGIGGL
GHVAVQYAIAMGLRVAAVDIADDKLALARELGAELTFNALDGDPAAAIQKEIGGTHGVLV
TAVSRSAFAQALGMVRRGGTVALNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
EFAAQGRVRARIHLDRLENINHVFGQLKSGQVDGRIVLKLD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaatgatgaaagccgctgtcgttcgcgaattcggcgcgccgctgcagatcgag
gaagtccccgtcccccggcccgggcgcggccaggttctcgtcaacgtgaaagcgtccggc
gtctgtcatacggatttgcacgccgccgatggcgactggccggtcaaaccggcgctgccg
ttcattcccgggcacgaaggcgtcggcgacgtcgcggcagtcggcgaaggcgtcacgcat
atcagggaaggcgatcgcgtcggcgtgccttggctgtacacggcgtgcggtcactgcgag
cattgcctcggcggttgggaaacgctctgccacgagcagcagaacacaggctattcggtc
aacggtgcctatgccgaatacgtgctggccgacccgaactatgtcggtcatctgcctgct
tccgtgtcattcgaagctatcgcgccgattctttgcgccggcgtgaccgtctacaaaggc
attcgcgtgacggatacgcggccgggccagtggatcaccatctccggaatcggcggtctg
ggtcatgtcgcggttcaatatgcgattgccatgggtctgcgcgtcgcggccgtcgacata
gccgacgacaagctcgcgcttgcgcgtgagctcggcgccgaactcacgttcaacgcgctg
gacggcgacccggccgccgcgattcagaaagaaatcggcggcacccacggtgtgctcgtg
accgccgtgtcgcgcagcgcgtttgcgcaggcactcggcatggtgcgccgtggcggcacg
gtcgcgctgaacggattgccgccgggcgactttccgttgccgattttttcgacggtgctc
aacggcatcaccgtgcgcggttcgattgtcggcacgcgcagggacttgcaggaatcgctc
gagtttgccgcgcaaggccgcgtccgggcgcgcattcacctcgaccggctcgagaacatc
aaccatgtctttgggcaactgaagagcggccaggtggatggccgcatcgtgctgaagctc
gactga

DBGET integrated database retrieval system