KEGG   Burkholderia sp. CCGE1001: BC1001_5582Help
Entry
BC1001_5582       CDS       T01424                                 

Definition
(GenBank) GMC oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00984  Steroid degradation
bug01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BC1001_5582
Enzymes [BR:bug01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     BC1001_5582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N Pyr_redox_2 NAD_binding_8 Hydrolase_4 FAD_binding_2 Abhydrolase_1 DAO FAD_oxidored FAD_binding_3 Pyr_redox HI0933_like Fer4_9 DUF4917 GIDA
Motif
Other DBs
NCBI-ProteinID: ADX58956
UniProt: E8YV21
Position
2:complement(2223292..2226702)
Genome map
AA seq 1136 aa AA seqDB search
MNRLSSAVTAMKSHYEVVVIGSGYGGAIAASRMARAGRSVCVLERGREFMAGEYPRTPFQ
GAEQIQYNTPAAQIGSPLALLEVHVNDDVNAVVGCGLGGTSLINANVALKLDPRLWDHAR
WPAALRADEAGRDTGYQRAWDMLQPSPVPARFRELPKLLALARSAEALGMAERFSTPPIT
VTFEDRTNAAGVAQKACTGCGDCNSGCNYDAKNSTHMNYLPDAVAHGAQIFTGAAVHSVT
RNAATQTWQVGYQLVRLGRESYDAPDLFVSADIVIVSAGTIGSTALLLRSRNEGLSVSGM
LGERFTGNGDVLAFAYNTDDTINGVGWGAHGEGDIPPVGPTITGLIDHRNTVDVKDGFVI
EEGSLAGPVGAALVGMLGAAAPLAGVDVSGPRTADRQLAYDARVVESFLHGPYRGALNHT
QSYLVMAHDDESGQISVNEKGRPRIAWENAGKQPIYETVEETLKNATVPLGGKYLRDPIS
NDIFGNRTVTVHPLGGCPMGEEAEHGVVDHMGRVFSGMAGTAVHDGLYVMDGAVMPMSLG
VNPLWTISALAERNCALLAASRGWTIDYDSKGTAAAPPPLKIGLRFTETMVGHYTPTGAS
KDAASPMAFTLTVESDDLADMLSDPNHLARTAGTLTCPALSAQPMTITDGTFNLFVADPQ
DVDERNMNYRMTLNSAEGKTYYLSGQKIITRTSPLELWEQTNTLYARVFDTPHADAAPLG
SATLIITPENFLKQQRTLEVTNAPDLATRLEWTLKFGKFFAGVLFSEYGGIAAPLQYYDP
DAKPRLKRALRAPAPQVFFFDTPDGTRLRLTRYVDPARKNARPVLLIHGSGVSSRIYSTD
LIDTNLVEYLCAAGYDVWLVDLRVSIEMPSVLVPTNVDKVALEDIPAAVTKIREVTGATA
IQALGHCMGGLALSMSLMAGLEGVRSAVISQVAVHPVPPTLGRIKAGLHIPDIMQHLGVT
DLNAYTQDEKWPHNLFDEALRLYPVDHDEGCGNPICHRATFMYGLLYEHAQVSETLHSNL
QELLGVHDVGVFRHLAAMVRAGNVVDADGNDVYLRGARGMKGLAGMRIPIGFIHGDRNET
YVPKSTALTYQMLVDAFPEQPYERYLIPGYGHIDCIFGKNAAVDVYPTIARYLNAH
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttatcgagcgccgtgacggcgatgaaatcgcactatgaagtggtggtgatc
ggttccggttatggcggcgccattgcggcgagccgcatggcccgcgcgggccgcagcgtc
tgcgtgctggagcgcgggcgcgagttcatggccggcgaatacccgcgcaccccgtttcag
ggcgccgagcagatccagtacaacacgcccgccgcgcagatcggctcgccgctcgcgctg
ctcgaagtgcatgtgaacgacgacgtcaacgcggtggtcggctgcggcctcggcggcacc
tcgctgatcaacgcgaacgtcgcgttgaagctggatccgcgcctgtgggaccacgcgcgc
tggcccgctgcgctacgtgcggacgaggccggacgcgacaccggttatcagcgcgcatgg
gacatgttgcaaccctcgccggtaccggcccgattccgcgaattgcccaagctgctcgcg
ctcgcacgatccgccgaggcgctcggcatggcggagcgcttcagcacgccgcccatcacc
gtcactttcgaggatcgcacaaacgcggccggcgtcgcgcagaaagcctgcaccggatgc
ggcgactgcaactcgggctgcaactacgacgcaaagaattcgacgcacatgaactatctg
cccgacgccgttgcgcacggcgcgcagattttcacgggcgccgcggtgcattcggtgacg
cgcaatgccgctactcaaacgtggcaagtcggctatcagctggtgcgccttggccgcgag
agctacgacgcgccggacctgttcgtgagcgcggacatcgtgatcgtatccgcgggaacg
atcggctcgaccgccttgctgctgcgttcgcgcaatgaaggcctgagcgtgtcgggcatg
ctcggcgagcgcttcaccggcaacggcgacgtgctcgcgttcgcgtacaacaccgacgac
accatcaacggcgtcggctggggcgcgcatggggaaggcgatatcccgccggtggggcca
accatcacggggttgatcgaccatcgcaataccgtcgacgtcaaagacggcttcgtgatc
gaagaagggtcgctcgccgggccggtcggcgccgcgctcgtgggcatgttgggcgccgct
gcgccgctcgccggcgtggacgtgtcgggaccgcgcacggcggaccggcagctcgcctac
gacgcccgcgtcgtcgaaagcttcctgcacggtccgtaccgcggcgcgctcaatcacacg
caaagctacctcgtcatggcgcacgacgacgaaagcggtcagatcagcgtcaacgaaaaa
ggacggccgcgcatcgcatgggagaacgccggcaagcagccgatctacgaaacggtcgaa
gagacgctgaagaatgcgacggtgccgctcggcggcaaatacctgcgcgatcccatttcc
aacgacatcttcggcaaccgcaccgtgaccgtgcatccactcggcggttgcccgatgggc
gaagaggccgaacacggcgtggtcgatcatatgggccgcgttttcagcggcatggccggc
acggccgtgcacgacggcctgtacgtgatggacggcgcagtcatgccgatgtcgctcggc
gtcaatccgctgtggacgatctcggcgctcgccgagcgcaattgcgcgctgctcgccgcg
tcgcgaggctggacgatcgactacgactcgaagggcaccgccgccgcgccgcccccacta
aaaatcggcctgcgcttcaccgaaacgatggtcgggcattacacgccgaccggagcaagc
aaggacgcggcaagcccgatggcgttcacgctgaccgtcgagtccgacgacctcgccgat
atgctcagtgatccgaaccatctggcgcgaaccgccggcacactcacctgccccgccctt
tccgcgcagccgatgacgatcaccgacggcaccttcaatctgttcgtggccgaccctcag
gatgtcgacgagcgcaacatgaactaccggatgacgctcaactcagcggaagggaaaacc
tactatctaagcggtcagaagatcatcacgcgcacgtcgccgctcgaactgtgggagcaa
accaacacgctttatgcgcgcgttttcgacacgccacacgccgacgcggcgccgctcggc
agcgcgacgctgatcatcacgccggaaaatttcctgaagcagcagcgcacgctggaagtc
acgaacgcgccggatctggcaacgcgtctcgaatggacgctcaaattcggcaagttcttt
gcgggcgtgctgttcagcgagtacggcggcattgccgcgcctttgcagtactacgatccc
gacgccaagccgcgcctgaagcgagccttgcgtgcaccggcgccgcaggtgttcttcttc
gacacgcccgacggcacgcgtttgcggcttacgcgctatgtcgatcctgcgcgcaagaac
gcacgccccgtgttgctgattcacggctcgggcgtgtcgagccgcatctactccaccgac
ctgatcgacaccaacctcgtcgaatatctgtgcgccgcgggctacgacgtctggctcgtc
gatctgcgcgtgagcattgaaatgcctagcgtgctggtgccgaccaacgtcgataaagtc
gcgctcgaggacattcccgcagccgtcacgaagattcgcgaagtgaccggcgctacggct
atccaggcgctcggccattgcatgggcggcctcgcgttgagcatgtcgttaatggcggga
ctggaaggcgtgcgctcggcggtgatctcgcaggtcgccgtgcatccggtgccgcccacg
ctcggccgcatcaaggcaggactgcacattcccgacatcatgcagcaccttggcgtgacc
gacctcaacgcttacacgcaggacgaaaagtggccgcacaatctcttcgacgaggcgctg
cgtctctaccctgtcgaccacgacgagggctgcggcaatccgatctgtcaccgcgcgacg
ttcatgtacgggctgctctacgagcatgctcaggtgagcgaaacactgcattcgaacctg
caggaactgctcggtgtgcatgacgtcggcgtgttcaggcatctggccgcgatggtgcgt
gcgggcaacgtcgtcgacgcggacggaaacgatgtctatctgcgcggagcgcgcggcatg
aaaggccttgccggcatgcgcattcccattggcttcattcacggcgaccgcaacgaaacc
tatgtgccgaagagcaccgcgctcacctatcaaatgctcgtcgacgcctttcccgagcaa
ccttacgagcgctatctgattcccggttatggacatatcgactgcattttcggcaagaat
gcggcggtcgatgtttatccgactatcgcgcgctatctgaacgcgcattga

DBGET integrated database retrieval system