KEGG   Burkholderia sp. CCGE1001: BC1001_5634Help
Entry
BC1001_5634       CDS       T01424                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
bug  Burkholderia sp. CCGE1001
Brite
KEGG Orthology (KO) [BR:bug00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bug02044]
    BC1001_5634
Secretion system [BR:bug02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1001_5634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ADX59008
UniProt: E8YV73
Position
2:complement(2286479..2287825)
Genome map
AA seq 448 aa AA seqDB search
MNYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSARFDRDALGSNVL
RVSELSLVFPDGALYSAPQADDLPPPIALDTLPDGINEFTFYLALHPLRETGANYSQDSN
AGFVARYVSEETPVADHFTDAAEADITFLKTSVKLIAHSEPRDQLLSVPLVRVRRTATSG
FEIDDSFVPPCLAIEASPVLHQRLRQLIDALQAKVNALYGFHREPTKNIIEFRSGDIASF
WLLHTASAAFASLAHLYQHSALHPERLFQELLRLAGQLMTFSKGYALSDLPAYRHDDPGP
GFARLDTILRDLLETVISTRYFAIALEEVRPSFHAGRLDSGKIDDKTLFYIAVSADMPTA
ELVEAVPARFKVGAPDDVDKLVLSAMPGVRLVYTPQVPPAIPVRPGACYFSCEPRGGLYE
RMLQAQSAMIYAPSGINDLQLELIAVTS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaattattccgcaaaagtgctctggggagaaggcctgtttctgcggccgcagcatttt
cagcgtcaggacgcctaccatgaggcgcgcctcttcgagtcgattcaggccatccagccg
tacaactggggcgtgcgctctgcgcgcttcgaccgcgacgcgctcggcagcaacgtgctg
cgcgtgagcgaactgtcgctggtgtttcccgacggcgcgctctactccgcgccgcaggcg
gacgacctgccgccgcccatcgcgctcgacacgctgccggacggcatcaacgaattcacg
ttttatcttgcgctgcatccgctgcgcgagacaggcgccaactattcgcaggacagcaac
gcgggcttcgtcgcgcgttacgtgagcgaagagacgccggtagcagatcatttcacggac
gccgccgaagccgacatcacctttctcaagacgagcgtcaagctgatcgcgcacagcgag
ccgcgcgatcaactgctctcggtgccgctcgtgcgcgtgcgccgcacggccacctcgggc
tttgaaatcgacgacagcttcgtgccgccctgtctcgcgatcgaggcatcgccggtgctg
catcagcggctgcgtcagttgatcgacgcattgcaggcgaaagtcaacgcgctgtacggc
tttcaccgcgagccgaccaagaacattatcgagttccgttccggcgacatcgcgtcgttc
tggctgctgcacacggcaagcgcggcgttcgcgtcgcttgcgcatctgtatcagcattcg
gcgctgcatccggagcgcctctttcaggaattgttgcgccttgccggccaactgatgacg
ttctcgaagggctatgcgctctccgatctgccggcttatcgccacgacgatccggggccc
ggcttcgcgcgcctcgacacgatcctgcgcgatctgctcgaaacggtgatctccacgcgg
tactttgccatcgcgctggaagaagtgcgcccgtcgtttcatgcgggccggctcgattcg
ggcaagatcgacgacaagaccctgttttacattgccgtgtccgcggacatgcccactgcc
gagctcgtggaagcggtacccgcgcgcttcaaggtgggggcgcccgacgatgtcgacaag
ctcgtgctctcggccatgccgggcgtgcggctcgtgtacacgccgcaggtgccgcccgcg
attccggtgcggcctggcgcctgctatttctcctgcgagccgcgcggcgggctgtacgag
cgcatgctgcaagcgcagtccgccatgatctacgcgccctcgggcatcaacgatcttcaa
cttgaactgatcgcggtcacctcatga

DBGET integrated database retrieval system