KEGG   Burkholderia sp. CCGE1001: BC1001_5641Help
Entry
BC1001_5641       CDS       T01424                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
bug  Burkholderia sp. CCGE1001
Brite
KEGG Orthology (KO) [BR:bug00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bug02044]
    BC1001_5641
Secretion system [BR:bug02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1001_5641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: ADX59015
UniProt: E8YV80
Position
2:2292949..2294787
Genome map
AA seq 612 aa AA seqDB search
MEELLPYYERELSFLRRYSRDFAERYPKIAARLAMSGEHCEDPHVERMIESFALLGARIN
KKLDDDYPEFTEALLEVLYPHYLRPFPSCSIAQLGTSAALSHLTEPVVIERGTELKSRPI
RGVQCRFRTAYDVTLAPLRISEAKYTSVAMAPSATVLPGNATAILSITFESTAAQLDLSA
LKVSTLRAHLHGEQSFIAALADCLFVNAMATYVEADRRGVWTPLRTPPLAQAGFDEHDAL
IDYPAKSHPAYRLLTEYFAFPDKFNFADFDLAAMTRTAGRCQRLTLHVVLKEVRSDSHVA
RLLDALSAHHFRLFCTPVVNLFEQHGEPIRVNHQAVSYPVVAEARRAFAYEVYSIDSVKL
VRQQAHQESVTEFRPFYSLHHGEAARAGHYWFARRNDWVAQKSPGYETEISIVDIDFEPA
APQTDTLSLDLTCTNRDMPAGLAVGLEGGDLFLEGGSLTGSIAMLRRPTPSVRFERGRAA
HWRLISHLALNHVSLTNSGLSALKEMLVLYDLRRTAVSARHIDGLVGIEQRAAVQWLPGK
PFATFVRGIEIRLTIDEEHFVGTSLASFVRVIDTFFGLYVHLNSFVQLVVVSKRTGEEIL
RCKPRSGESILA
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaagaattgctgccgtattacgagcgcgaactgtcgtttctacggcgctattcgcgc
gatttcgccgagcgctacccgaagatcgcggcgcgtcttgccatgtccggcgagcactgc
gaagatccgcacgtcgagcggatgatcgagtcgttcgcattgctcggcgcgcgcatcaac
aagaagctcgacgacgactaccccgaattcacagaagcgctgctggaagtgctgtacccg
cactatctgcggccctttccctcctgttccatcgcgcagttgggcacttccgcggcgcta
agccatctgaccgaaccggttgtcatcgagcgcggcaccgaactgaagtcgcggcccatt
cgcggtgtgcagtgccgtttccgcaccgcgtacgacgtcacgctcgcaccgctgcgcatt
tccgaggcgaagtacacgtcggtggccatggcgccgagcgcgacggtattgccgggcaat
gccaccgcaatcctgtccatcacctttgaatcgaccgctgcgcaactcgacctgtctgca
ttgaaagtcagcacattgcgcgcgcatctgcatggcgagcagtcgtttatcgcagcgctg
gcggactgcctgttcgtcaatgcaatggcgacctatgtggaggcggaccggcgcggcgtg
tggacgccattgcgcacgccgcctctcgcgcaagcgggttttgatgaacatgacgcactg
atcgactatccggcgaaatcgcacccggcttaccggcttctcaccgagtactttgccttc
ccggacaaattcaatttcgctgacttcgacctcgcggccatgacgcgaaccgcgggccgc
tgccagcgcctcacgctgcatgtggtgctgaaagaagtgcgcagcgattcgcatgtggcg
cgccttctcgacgcgttgtccgcgcaccacttccggctcttctgcacgccggtcgtcaac
ctgttcgagcagcacggcgagccgattcgcgtgaaccatcaggcggtctcttacccggtg
gtggccgaagcgcgccgcgccttcgcatacgaggtttattccatcgattcggtgaagctc
gtcaggcaacaggcgcatcaggaatccgtgactgagttccggccgttctattcgctgcat
catggagaagccgcgcgcgccggacactactggttcgcgcggcgcaacgattgggttgcg
caaaaaagccccggctacgagacggagatttcgattgtcgacatcgacttcgaaccggcc
gcaccgcaaaccgatacgttgagcctcgatctcacctgcaccaatcgcgatatgcccgcg
gggctcgcggtgggcctcgagggcggcgatctgttcctggaaggcggatcgctgaccggc
agcatcgcgatgctgcgccggccgacgccgagcgtgcgtttcgaacggggacgcgcggcg
cactggcggctcatttcacatcttgcgctgaatcacgtgtctctgacgaacagcggtctt
tccgcgttgaaggaaatgctggtgctctacgatctgcggcgcacggcggtatcggcgcgg
catatcgacggacttgtcggaatcgagcagcgtgcggccgtgcaatggcttcccggcaaa
ccgttcgcgactttcgtgcgcggcatagaaattcgcctgactatcgacgaagaacatttt
gtgggtacgagtctcgcgtcgttcgtgcgagtgatcgatacattcttcgggctgtacgtg
catctgaacagctttgtgcaactggtcgtcgtgtcgaaacgcacgggcgaggagatcttg
cgatgcaaaccgcgcagcggcgaatcgatcctggcgtag

DBGET integrated database retrieval system