KEGG   Burkholderia sp. CCGE1001: BC1001_5642Help
Entry
BC1001_5642       CDS       T01424                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
bug  Burkholderia sp. CCGE1001
Brite
KEGG Orthology (KO) [BR:bug00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bug02044]
    BC1001_5642
Secretion system [BR:bug02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1001_5642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: ADX59016
UniProt: E8YV81
Position
2:2294751..2295845
Genome map
AA seq 364 aa AA seqDB search
MQTAQRRIDPGVVEQLLDEPHRFEFFQAVRVLEKWFAQQAPSATGRSGDIVAQRIAFRNS
LSISFPPSEIHGAQSYDDNGAALKEKPQRTEALENGLLDKVDITPAFFGLLGGQGALPLH
YTEQIIAREQIKRDRAAREFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAL
AGVSDNDTRSSLQSGDGALFDEAIAGYALPARHRPVSAAYLQRTLSDYFKVPVRVEQFVG
KWYDVPRDQLTVLGSVNATLGATALAGERVWQRDMRARLVIGPLDKADYEAFLPGADRAV
ALERMLTLLAGVTLEYEVSLVLRREAVGPTLLSQGARLGWDAFLSTRDAERDRTDARYEL
HVIH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgcgcagcggcgaatcgatcctggcgtagtcgagcagcttctcgacgagccg
catcgctttgagttttttcaggcggtgcgcgtgctcgagaagtggttcgcacagcaagcg
ccgtcggccaccggcagatccggcgacatcgtcgcgcagcgcattgcctttcgcaattcg
ctgtccatctcatttccgccgagcgaaattcacggcgcgcaatcctacgacgacaacggc
gccgcgctaaaggaaaagccgcagcgcacggaggcgctcgaaaacggcttgctcgacaaa
gtggacattacgccggcgtttttcggtttgctcggcgggcagggcgcgttgccgctgcat
tacaccgagcagatcatcgcgcgtgaacagatcaagcgcgaccgcgccgcgcgcgagttc
ttcgatgtcttttcgaatcgggccactgcgctcttctatgcggcgtggaaaaagtaccgc
ttgccgttccactacgaactggatcgcgacgaacgctatttgccattgctgcttgcgctt
gccggcgtatccgacaacgacacccgcagcagcctgcaaagcggagacggtgcgctgttc
gacgaagcgattgcaggctatgcactgcccgcgagacaccggcccgtttcggcggcctac
ttgcaacgcacgctgtcggactacttcaaggtaccggtgcgcgtcgagcagttcgttggc
aaatggtatgacgtaccgcgcgatcaattgaccgtactcggcagtgtcaacgcgacactc
ggcgcaacggcgctggcgggcgagcgcgtgtggcagcgcgacatgcgggcacggctcgtc
atcggcccgctcgacaaggcggattacgaggcctttctgccgggcgccgatcgcgcggtg
gcactcgaacgcatgctgacgctgctcgccggcgtcacgctcgaatacgaagtgtcgcta
gtgctgcgacgcgaggcggtggggccgacgctgctgagtcaaggcgcgcgccttggctgg
gacgctttcctctcgacgcgcgacgccgagcgcgaccgcaccgatgcccgctacgaactg
catgtgattcactga

DBGET integrated database retrieval system