KEGG   Burkholderia sp. CCGE1001: BC1001_5647Help
Entry
BC1001_5647       CDS       T01424                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bug00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BC1001_5647
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bug02044]
    BC1001_5647
Secretion system [BR:bug02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1001_5647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C HemX DUF4381
Motif
Other DBs
NCBI-ProteinID: ADX59021
UniProt: E8YV86
Position
2:complement(2301766..2305641)
Genome map
AA seq 1291 aa AA seqDB search
MRRFFNVLTHPRTLSIIGLLALAAVLFVGADTLQIDLMWPAIALAALVALWLLVWVVRRL
RARRANDKLGEMLEQQAEKQSADAGPAPTPARQAELDVLRTRLVDAVKTIKTSKIGQLSG
GSALYELPWYIVIGNPAAGKSSAVLNSGLQFPFADKNNAVIHGIGGTRNCDWFFTTEGIL
LDTAGRYSVHEEDRTEWLGFLGLLKKFRPKAPINGIIVTASIAELTSSKPEFAINLAKNL
RQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSGSDRHEYDRVWGATLPYEPDEKRDV
VGLFDEHFEELYDGLKEISVAQMSINRGNKLSPGQLSFPLEFSTIKPALRAFLATLFETN
PFQYKPIFRGFYFTSALQEGETSSAAATRIANRFGLSAESMPKPQSAFSKNGFFLRDLFS
KVIFADRQTVRQFASPAKTRMRYATFFGFVAVLALALGGWTWSTVNNQQLAENVKADLDN
VVRLQQNRNDLQSRLQAMDVLEDRIDQLEQFRRDKPLAVSLGLYQGDRLEQRLLTEYYNG
VRQILLDPVSQNLASFLKDVNAHPDQLAPLNRTPDAAAIPVSTHSAMTASGQGGLYSDAS
PTNVEDAYNALKTYLMLSDKRHVETAHLTDQVARFWRGWLETNRGNMPRDEMIRSAERMI
TFYLSRVSDDDWPMIDQNLGLVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIA
RIVGENNTALVAGSYAIPGTFTREAWFQYVQPAIREAATKELQAKDWVLNTSAHDDLTLE
GSPEQIQKALVTMYKTEYAMHWQKFMQGIAVQSFGSFGQAVDAMNRLGDPQDSPIRKVLE
TAYDQTSWDNPSLFNASLKRAQSGVTSWFKQWFSRAPTGQLNANIDINGNPVEMPMGPIG
QEFSALGRIVQTGDNGSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGSGSE
LADSLKYVDEQMLTGLTDSQRKALRPLLVRPLMAAYAVVIQPASVEVNKVWNAQVYQTFQ
NSLASKYPFSGDAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLTARTWGDMG
LALTPDFTNGFARWVAPLAGGAAGASAGQSSAEPQTVFQILPQPSSGTTEYTLAIDGQQM
RYRNTPPQWTNFVWPNPSGSPGATLSATTFDGRTLQLVNEPGRYGLEKLINSAQRKRRPD
GTFDLSWTQGNVTVAVSMRIISTSQASGGSSDAPQQQSLRGLRLPSSVADVSAAANSVAA
TNTASSAAPVASAVPAARPATAAVSNTGGAQ
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgctttttcaacgtgttgacccatccacgcacgctctcgatcatcggcctgctc
gcgctcgctgcggtcctcttcgtcggcgccgatacactgcagatcgacctgatgtggccg
gccatcgcgctcgctgcgctcgtcgcgctatggctgctcgtatgggtggtgcgccgcctg
cgcgcgcgtcgcgcgaacgataagctcggcgaaatgctcgagcagcaggcggaaaagcag
agcgccgacgcgggaccggcgcccacgccggcgcgccaggcggaactcgacgtgctgcgc
acgcgcctcgtcgacgcggtcaaaaccatcaagacttcgaagatcggccagctgtcgggc
ggctcggccttgtatgaactaccgtggtacatcgtgatcggcaatcccgccgcgggcaaa
agcagcgccgtgctgaactcgggcttgcaattcccgttcgccgacaaaaacaacgcggtg
atccacggcattggcggcacgcgcaattgcgactggttcttcacgacagagggcattctg
ctcgacacggcaggacgctactccgtgcatgaggaagaccgtaccgaatggctcgggttt
ctcggcctgctcaagaagttcaggcccaaagcgccgatcaacggcatcatcgtgaccgcg
agcattgcggaactcaccagcagcaagcctgaattcgccatcaatcttgcgaagaacctg
cgccagcgcgtgcaggaattgaccgaaaagctggaggtgttcgcgccggtctacgtgatg
ttcaccaaggccgacctgatcacaggcttcaccgaattcttcagcggcagcgaccgtcac
gaatacgaccgcgtgtggggtgccaccctgccctacgagccggacgaaaagcgcgacgtg
gtcggccttttcgacgaacacttcgaagaactctatgacggcctgaaagaaatcagcgtc
gcgcagatgtcgatcaaccgcggcaacaagctctcgccaggccaactgagcttcccgctc
gaattctccacgatcaagcccgcgcttcgcgcctttctcgccacgctgtttgaaacaaac
ccgttccagtacaagccgatcttccgcggcttctatttcacgagcgccttgcaggaaggc
gaaaccagcagcgccgcggccacgcgcatcgcgaaccgcttcggcctgagcgccgaaagc
atgccgaagccgcagagcgcgttctcaaagaacgggttcttcctgcgcgacctcttttcc
aaggtcatcttcgcggaccggcaaacggtcaggcaattcgccagccccgcgaagacgcgc
atgcgctacgcaacgtttttcggcttcgtcgccgtgctcgcgctggcgctcggcggctgg
acatggtcgaccgtcaacaatcagcaactcgcggagaacgtcaaggccgatctcgacaac
gtcgtgcgtttgcagcagaaccgcaacgacctgcaatcgcgactgcaggcaatggacgtg
ctcgaagaccgtatcgatcagctcgaacagttccgccgcgacaagccgctcgctgtttcg
ctcggcctgtatcagggcgatcgtctcgaacagcgtcttctgaccgagtactacaacggc
gtgcgtcagattctgctggatccggtttcgcagaacctcgcgtcgttcctgaaggacgtc
aacgcgcatccggatcagctcgcgccgctcaatcgcacaccggacgccgccgcgattccc
gtctcgacgcatagcgccatgacggcgagcggccagggcggcctttacagcgacgcgtcg
cctaccaatgtggaagacgcatacaacgcgctcaagacgtacctgatgctcagcgacaag
cgtcacgtggaaacggctcacctgaccgaccaggtggcgcgtttctggcgcggctggctc
gaaacgaatcgcggcaacatgcctcgcgacgaaatgatccgcagcgccgagcgcatgatc
accttttacctgtcccgcgtgtccgacgacgactggccgatgatcgaccagaacctcggc
ctcgtcgatcagactcgcgagaacctgcgtcgcgtggtgcgcggcatgccggcgcgtcag
cgcgtctatgaggagatcaaggcgcgcgcctccacccgctttgcgccgatgaccatcgcg
cgcatcgtcggtgagaacaatacggcgctcgtggcgggcagctacgcgattcccggcaca
tttacgcgggaagcgtggttccagtatgtgcagcccgcgattcgcgaggcggcgacgaag
gaattgcaggcgaaagactgggtgctcaacacctccgcgcatgacgacctgacgctcgaa
ggcagccccgagcagatccagaaagcactggtcacgatgtacaagaccgagtatgcaatg
cactggcagaagttcatgcaaggcatcgcggtgcagagcttcggcagcttcgggcaggct
gtggacgcgatgaaccgcctcggcgacccgcaggattcgccgatccgcaaagtactcgaa
accgcgtatgaccagacttcgtgggacaacccgtcgctcttcaacgcgagcctgaaacgc
gcgcaaagcggcgtgacgagctggttcaagcaatggttctcgcgcgcgccgaccggccag
ctgaacgcgaacatcgacatcaacggcaatccggtggaaatgccgatgggtcccatcgga
caggaattttccgcgctggggcgtattgtccagacgggcgacaacggctcgatgctcaag
ggctatatggacacgttgtccaaggtccgcacgcgctttaacgtcatcaagaaccagggc
gatccgggaccgggcgcgcgtcagctcatgcagcagacgctcgacgggagcggctccgaa
ctcgcggattcgctcaagtatgtcgacgagcagatgttgacgggcctcaccgattcgcag
cgtaaagccctgcgtccgctgctcgtacgccctttgatggccgcgtacgccgtggtgatc
cagcctgccagcgtcgaagtcaacaaggtgtggaatgcacaggtgtaccaaacattccag
aactcgctcgccagcaaatatccgttttccggcgacgcgaaggtggaagccggtgctggt
gaaatcgcacaggtgttcggaccggacggctcgattgcgaagttcgtcggcaccacgctc
gggccgctcgcggtgcgccgcggcgacacgctgacagcgcgcacatggggcgacatgggc
ctcgcgctcacgccggacttcacgaatgggttcgcgcgctgggtcgcgccgcttgcgggc
ggtgcagcgggcgcctcggcaggccagagctcggcggaaccgcagaccgtgttccagatc
ctgccgcagccgagcagcggcacgaccgagtacacgctcgccatcgacggccagcagatg
cgttaccgcaacacgccgccgcaatggaccaacttcgtgtggccgaatccgtcggggtcg
cccggcgccacgctgtcggccacgaccttcgacggacgcaccttgcaactcgtcaacgaa
ccgggccgctacggtctcgagaagctgatcaattcggcgcagcgcaagcgtcgcccggac
ggcaccttcgatctgtcgtggacgcaaggcaacgtgacggtggcggtcagcatgcgcatc
atcagcacgtcgcaagcctcgggcggcagcagcgacgcgccgcagcagcaaagcctgcgt
gggctgcgtctgccttcttcggtggcggacgtaagcgcggcggccaattccgtcgctgcc
acgaacacagccagtagtgcggcgcccgtcgcgtcggcggtgccggcggcgcggccggcc
acggccgcggtttcgaacacaggaggtgcgcaatga

DBGET integrated database retrieval system