KEGG   Burkholderia sp. CCGE1001: BC1001_PA6259Help
Entry
BC1001_PA6259     CDS       T01424                                 

Gene name
hisP
Definition
(GenBank) Histidine transport ATP-binding protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bug00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BC1001_PA6259 (hisP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bug02000]
    BC1001_PA6259 (hisP)
Enzymes [BR:bug01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     BC1001_PA6259 (hisP)
Transporters [BR:bug02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BC1001_PA6259 (hisP)
   Histidine transporter
    BC1001_PA6259 (hisP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_16 AAA_13 AAA_22 APS_kinase ATPase_2 PRK AAA_33 G-alpha Zeta_toxin RsgA_GTPase DUF87 AAA_23
Motif
Other DBs
NCBI-ProteinID: AMD29207
UniProt: A0A125RGC2
Position
pCCGE1001a:172197..172976
Genome map
AA seq 259 aa AA seqDB search
MKTQNHKVFVEDLHKQYGSIEVLKGVSLRANAGDVISVIGSSGSGKSTMLRCINFLEQPN
AGHIFIDGEEVRTHRDKTGTLKATDSAQLRSVRTKLAMVFQHFNLWAHMNVIENVIEAPM
HVLKLSRREAEERAREYLEKVGLAPRVEKQYPSHLSGGQQQRVAIARALAMHPDVMLFDE
PTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRVEEEGAPAE
VFGNTRTERLKQFLSGSLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacagaatcacaaggtatttgtcgaagatctgcataagcagtacggtagcatc
gaagtcctgaagggtgtctcactgcgcgcaaacgcgggcgacgtgatcagcgtcatcggg
tcatccggatcgggaaagagcacgatgcttcgttgtatcaattttctcgagcagccaaac
gcggggcacatcttcatcgatggcgaggaagtgcggacacatagagacaagaccggtacc
ctcaaggcgactgatagtgcgcagctacgcagtgtgcgcacgaaactcgcaatggtgttc
cagcacttcaatctgtgggcgcacatgaatgttattgaaaacgtgattgaagcgccaatg
cacgtgttaaagctttcaaggcgcgaagccgaggaacgtgcgcgagagtatctcgagaaa
gtcggactagccccacgcgttgagaagcaatatccatcgcatctctccggcgggcagcag
cagcgcgtcgcgatagcgcgtgcgcttgcgatgcatccggacgtgatgctgttcgacgag
ccgacgtcggccctcgatccggagctcgtcggcgaagtgctgaaggtgatgcagaagctg
gccgaagaaggccgcacgatgattgtcgtcacgcacgagatgggctttgcgcgcaacgtc
tccaaccatgtgatgttcctgcatcagggacgcgttgaggaagagggggcgcctgccgag
gtttttggtaacacgcggactgagcgcctgaagcagttcctgtcgggcagcctgaaatag

DBGET integrated database retrieval system