KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_201Help
Entry
BUAMB_201         CDS       T01830                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine-D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
buh00471  D-Glutamine and D-glutamate metabolism
buh00550  Peptidoglycan biosynthesis
buh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BUAMB_201 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BUAMB_201 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buh01011]
    BUAMB_201 (murD)
Enzymes [BR:buh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BUAMB_201 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:buh01011]
 Precursor biosynthesis
  Amino acid ligase
   BUAMB_201 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C UT LytB_WW
Motif
Other DBs
NCBI-ProteinID: AEO08024
UniProt: G2LP87
Position
complement(226909..228228)
Genome map
AA seq 439 aa AA seqDB search
MSYNYFGKKILILGIGLTGISCINFFLKKGITPKIIDESKNPILFMKIPKNIQYSLGSLE
HKWILESDLIIISPGISTFKPHLIKARLLGIEIISDIELFAREVTVPVIAITGTNGKSTV
ATMITKIAKYSGFHVLLGGNIGLPVLDILHKKTDLYIIELSSFQLENTFNLKAKIAVILN
IYKDHINRYPEGFEQYKNTKLSIFHQADTCIINSNDQLENILYKNKKNFISFGKKSSDYY
ICSTSNAYILCYKNQKILNSSELLLSGYHNYNNVLVSIAIADAMKFSRKNTIYALKKFVS
LPHRFQTIKNENGINWINDSKSTNVNSTEAALNALKIKGTIHLLLGGDSKSNTFDILKTY
FKKTKIKIYCFGKDGIKISKVCKKKSVYVDNLKQAMILIVKNVQSGDTVLLSPGCSSLDQ
FSNFEERGNFFIKLIKDMT
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacaattattttggtaaaaaaatattaattttaggtataggattaactggtata
tcttgtattaatttttttttaaaaaaaggtataacaccaaaaatcatagatgaatctaaa
aaccctatattatttatgaaaattcctaaaaatattcaatatagtttaggtagtttagag
cataaatggattttagaatcagacttaattattatcagtccaggaatttccacttttaaa
ccacatttaataaaagcacgtttattaggtattgaaattattagtgatatagaattattt
gcaagagaagtaactgttccagttattgcaattacaggaacaaatggaaaaagtactgta
gctacaatgattacaaaaattgctaaatattctggttttcatgttttgttaggaggcaat
attggcttacctgtactcgatattctacataaaaaaacagatttatatataatagaatta
tctagttttcaactagaaaatacatttaatttaaaagcaaaaatagctgttattctaaat
atctataaagatcatataaatcgatatccagaaggttttgaacaatataaaaatactaaa
ttatctattttccatcaagcagatacttgtattattaattctaatgatcaattagaaaat
attttatacaaaaataagaaaaattttattagttttggaaaaaaaagtagtgattattat
atttgttcaacatcaaacgcttatattttatgttataaaaatcaaaaaatactgaatagt
tctgaattattattatctggttatcataattataataatgtattagtttctattgctatt
gcagatgcaatgaaattttctagaaaaaatacaatatatgcattaaaaaaatttgtcagt
ttacctcatcgttttcaaactattaaaaatgaaaacggtataaattggataaatgattct
aaatctactaatgtaaatagtactgaagccgctttaaatgctttaaaaataaaaggtaca
atacatttattattaggaggagacagtaaatctaatacttttgatatattaaaaacatat
tttaaaaaaacaaaaataaagatttactgttttggtaaagatggaataaaaatctctaag
gtatgcaaaaaaaaatctgtttatgtagataatttaaaacaagcaatgatattaattgta
aaaaatgttcaatcaggtgataccgtacttttatcccctggatgtagtagtttagatcaa
ttttctaattttgaagagcgaggtaatttttttataaaattaatcaaggacatgacttaa

DBGET integrated database retrieval system