KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_204Help
Entry
BUAMB_204         CDS       T01830                                 

Gene name
murE
Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
buh00300  Lysine biosynthesis
buh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:buh00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BUAMB_204 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BUAMB_204 (murE)
Enzymes [BR:buh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BUAMB_204 (murE)
Peptidoglycan biosynthesis and degradation proteins [BR:buh01011]
 Precursor biosynthesis
  Amino acid ligase
   BUAMB_204 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AEO08026
UniProt: G2LP89
Position
complement(230652..232145)
Genome map
AA seq 497 aa AA seqDB search
MNKTCLKYLLSPWIKYAPKKNILHLNMDSRQSTEGELFLAVKGINQDGRHFILQVIKKKV
AAILYDTHKKIEHGTCKYINHIPIIKFFSLSKNISMLASRFYKQPEKKLKIIGITGTNGK
TTVTQLINQWSYFLGYKTATMGTLGNGFHNSLYPTKNTTSSAIVIHSFLSMVLKEKAKLV
TMEISSHGLIQNRVISIPFYIGIFTNLTQDHLDYHKNMEKYEAAKWLLFSTHKVKKIILN
ADNEYGKKWLKKLFNYYTVAVTIQNDTQKKYSTKWLNATKIKFRNHYVHITFESSWGNAE
ILSCLIGDFNVINILLSLAALLELGHNLSDIVNMSKKIKPINGRMQIFTKKNKPIFIIDY
AHTPDALKKTLNAIQLHYKKYIWCIFGCGGERDKTKRSIMGNIAENMSNQVIITNDNPRN
EKEKKIIQNILSGCKKKDKIIIIPNRKKAISYAYFKAKYNHIIFIAGKGHETQQIIRNKS
IIYSDQKTVLNLLEKNI
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacttgtttaaaatatttactatctccatggatcaaatatgctccaaaaaaa
aatattttacatttgaatatggatagcagacaatcaactgaaggagaactatttttagct
gttaaaggtattaatcaagatggacgtcatttcattttacaagtcattaaaaaaaaagta
gcagcaatcttgtatgatacgcacaaaaaaatagaacatggaacatgtaaatatatcaat
catattcctataataaaatttttttctctatctaaaaacatatcaatgttagccagtcgt
ttttataaacaaccagaaaaaaaattaaaaattataggaatcactggaactaatggtaaa
acaactgtaacacaattaattaaccaatggagttattttttaggttataaaactgcaacg
atgggaactttaggaaatggttttcataattctttatatccgacaaaaaacactacatct
tcagctattgtcattcattcttttttatcaatggtattaaaagaaaaagctaaattagtt
actatggaaatctcttcacatggtttaatacaaaatcgtgttatatctattccgttttat
attggaatatttacaaatttaacacaagatcatttagattatcataaaaatatggaaaaa
tatgaagcagcaaaatggttattatttagtacacataaagtaaaaaaaattatattaaat
gctgataatgaatatggaaaaaaatggttaaaaaaattatttaactattatacagtagca
gtaactattcaaaatgatactcaaaaaaaatattctacaaaatggttaaacgctactaaa
attaaatttcgtaatcactatgtgcatattacatttgaatcgagctggggaaatgctgaa
atattatcttgtttaattggagattttaatgtaataaatattttattatcattagcagct
cttttagaattaggtcataatctatcagacatagttaatatgtctaaaaaaataaagcct
ataaatggtcgaatgcaaatcttcactaaaaaaaataaaccaatttttattattgattat
gcacatacacctgatgcattaaaaaaaacactcaatgcaattcaattgcattataaaaaa
tatatatggtgtatatttggatgtggaggtgaaagagataaaacaaaacgttctattatg
ggaaatattgcagaaaatatgtcaaatcaagtaatcattactaatgataatccaagaaat
gaaaaagaaaaaaaaattattcaaaatattctcagcggttgtaaaaaaaaagataaaata
ataattattcccaatagaaagaaagcaatatcttatgcttattttaaagcaaaatataat
cacataatttttatagccggaaaagggcatgaaacacaacaaattattcgaaataaatct
attatttattcagaccaaaaaacagtattaaatttattggaaaaaaatatatga

DBGET integrated database retrieval system