KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_258Help
Entry
BUAMB_258         CDS       T01830                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
buh00260  Glycine, serine and threonine metabolism
buh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
buh01100  Metabolic pathways
buh01110  Biosynthesis of secondary metabolites
buh01130  Biosynthesis of antibiotics
buh01230  Biosynthesis of amino acids
Module
buh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:buh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUAMB_258 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BUAMB_258 (trpA)
Enzymes [BR:buh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BUAMB_258 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG
Motif
Other DBs
NCBI-ProteinID: AEO08075
UniProt: G2LPD8
Position
complement(288195..289004)
Genome map
AA seq 269 aa AA seqDB search
MSRYLNMFNKLAILKEGCFVPFVVLGDPSLEISINIINILIENGADALEIGIPFSDPLAD
GPIIQKANLRALDQNQNILKYFKILKKIREENISLPIGILIYANLVYNQGIDNFYLQCSN
SGLDSVLIADVPIEESKIFYHTANKYRIDSIFICPPNADDNFLYNLALYAKGYIYVLSRS
GVTGINHSTTLLSPELIKRIKKYNSLPLLQGFGISNPIQIKKAISSGLSGVICGSAIINI
IEKYLHQEEKMIKKIKKFTKLLKLSTKFQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgatatttaaacatgtttaataaattagctattttaaaagaaggatgttttgtt
ccttttgtagttttaggagacccttctttagaaatttcaataaacattatcaatatttta
attgaaaatggggctgatgctttagaaattggtattccattttcagatccattagcagat
ggaccaattatccaaaaagcaaatttacgtgctctagatcaaaaccaaaatattttaaaa
tattttaaaatattaaaaaaaatacgcgaagaaaacataagtttacctatcggtatttta
atatatgctaatcttgtatataatcaaggtattgataatttttatttacaatgttctaat
tctggattagattcggtacttatagcagatgttcccattgaagaatcaaaaattttttat
catactgcaaataaatatcgcattgattctatttttatttgtcctccaaatgcagacgat
aattttttatataatcttgctttatatgcaaaaggttatatttatgtattatctcgttct
ggagtaactgggataaatcattcaacaacattattatcgccagagttgatcaaaagaata
aaaaaatataattctcttcctttattacaaggttttgggatttctaatcctatacaaata
aaaaaagcaatatcatctggtttatctggtgtaatatgcggttcagctattataaacata
attgaaaaatatttgcatcaagaagaaaaaatgataaaaaaaataaaaaaatttactaag
ctattaaagttgtctactaaatttcaataa

DBGET integrated database retrieval system