KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_260Help
Entry
BUAMB_260         CDS       T01830                                 

Gene name
trpC
Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
buh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
buh01100  Metabolic pathways
buh01110  Biosynthesis of secondary metabolites
buh01130  Biosynthesis of antibiotics
buh01230  Biosynthesis of amino acids
Module
buh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:buh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BUAMB_260 (trpC)
Enzymes [BR:buh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BUAMB_260 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     BUAMB_260 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEO08077
UniProt: G2LPE0
Position
complement(290226..291599)
Genome map
AA seq 457 aa AA seqDB search
MQETILEKIIQDKRSWIIIQKKIQPLMTFQNKINTQTRDFFYALKQKKPCFILECKKTSP
SLGIIRNNFNILKIANIYKKYASAVSVLTDEKYFHGNLKFINMVREHITQPILCKDFFID
VYQIYLARYYHADAILLMLSILNDEKYKELAITAKQLNMSILTEVNNAQELQRALKLNAD
IIGINNRNLHDLSINLNRTRILASIIQKNKIKNKIIISESGITKYSQIRELSKFVDGFLI
GSHLMSQKNLEIGVRSIILGNNKVCGLTRNIDVKYVEKYGAIYGGLIFVQNSPRYITCQI
AKKIIKNSQLRYIGIFQNENIQIISHIAQELSLYAIQLHGDENQEYINMLRKTLPKTIKI
WKAFSITCMLPIRNLNNVNMYVFDSYVGGSNISFNWSILKNSILDNVILAGGINIDNVMQ
ASFLNCSGLDFNSGVEISPGIKDPKKIELIFQKLRYY
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaacaatacttgaaaaaattatacaagataaacgatcttggattataattcaa
aaaaaaatacaaccattaatgacttttcaaaacaaaattaatacacaaacacgtgatttt
ttttatgctttaaaacaaaaaaaaccatgttttatattagaatgtaaaaaaacttctcct
tctttaggtataattcgaaataattttaatatattaaaaattgctaatatttataaaaaa
tatgcttctgctgtttcagtacttacagatgaaaaatactttcatggaaatttaaaattt
attaatatggtgcgcgaacatattactcaacctattttatgcaaagatttttttattgat
gtatatcaaatttatttagctagatattatcatgcagatgctattttattaatgttatct
atattaaatgatgaaaaatataaagagttagcaattacagcaaaacaattaaatatgagt
atattaactgaagtaaataatgcacaagaattacaacgcgctctgaaattaaatgctgat
attattggaattaataatcgaaatttacatgatttatcaattaatttaaatcgtactcgt
atattagcatcaataattcaaaagaataaaattaaaaataaaataattattagtgagtct
ggtattactaaatattctcaaattagagaactaagtaaatttgtagatggttttttaatt
ggttctcatttaatgtctcaaaaaaatttagagataggtgtacgttctataattttaggt
aataataaagtttgcggattaactcgtaatattgatgtaaaatatgttgaaaaatatggt
gcaatttatggtggacttatttttgtgcaaaattctccgcgttatattacttgccaaatt
gcaaaaaaaattattaaaaatagtcaattaagatatattggaatatttcaaaatgaaaat
attcaaataatttctcatatcgctcaagaactttccttatatgcaattcaattacatggt
gatgaaaatcaagaatatattaatatgttaaggaaaacattaccaaaaacaataaaaatt
tggaaagctttctctattacttgtatgttaccaattcgtaatttaaataatgtcaatatg
tatgtatttgattcttatgttggggggagtaatatatcttttaattggtctattttaaaa
aatagtattttagataatgttattctagcaggtggaataaatatagataatgtgatgcaa
gcatcttttctaaattgttcaggtttagattttaactctggtgtagaaatttctccagga
attaaagaccctaaaaaaattgaattaatttttcaaaaattacgatattattaa

DBGET integrated database retrieval system