KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_286Help
Entry
BUAMB_286         CDS       T01830                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
buh00010  Glycolysis / Gluconeogenesis
buh00030  Pentose phosphate pathway
buh00051  Fructose and mannose metabolism
buh00680  Methane metabolism
buh01100  Metabolic pathways
buh01110  Biosynthesis of secondary metabolites
buh01120  Microbial metabolism in diverse environments
buh01130  Biosynthesis of antibiotics
buh01200  Carbon metabolism
buh01230  Biosynthesis of amino acids
buh03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:buh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUAMB_286 (pfkA)
   00030 Pentose phosphate pathway
    BUAMB_286 (pfkA)
   00051 Fructose and mannose metabolism
    BUAMB_286 (pfkA)
   00052 Galactose metabolism
    BUAMB_286 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BUAMB_286 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BUAMB_286 (pfkA)
Enzymes [BR:buh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BUAMB_286 (pfkA)
Protein phosphatases and associated proteins [BR:buh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BUAMB_286 (pfkA)
Messenger RNA biogenesis [BR:buh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BUAMB_286 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEO08102
UniProt: G2LPG5
Position
324347..325309
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSEKLEVFGIYDGYLGLYENRMVMLDRYSVSD
MINRGGTFLGSARFSDFCQEHIRAIAVQNIKKRKIDALVVIGGDGSYIGAKKLTDMGISC
ISLPGTIDNDVPGTDYTIGYFTALQTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLS
AAIAGGCEFIVLPEIHFKKEELVLEIQAGITKGKKHAIVAITECICDVKELAEYIEHQTK
RETRATILGHIQRGGSPGAYDRILASRMGAYSVELLLKGYKGKCVGIKNDKIVFNDIENA
LKNMKYIFKKELLMTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattggcgtcttaactagcggtggtgatgctccaggtatgaacgccgca
attagaggagtcgttagaacagcactgagtgaaaaattagaagtttttggaatttatgat
ggatatttaggtttatatgaaaatagaatggtcatgcttgatagatatagtgtatctgat
atgattaatcgaggtggaacatttttaggttctgcaagattttctgatttttgtcaagaa
catatacgtgctattgcagtacaaaatattaaaaaaagaaaaatagatgctcttgttgta
attggaggagatggctcttatataggagctaaaaaattaacagacatgggtatttcatgc
attagtttaccaggtactattgataatgatgttccaggtactgattatacaataggttat
tttacagctttacaaacagttgttgaagcaatagatagattaagagatacttcttcttct
catcaacgtatttctatagttgaagttatgggtagatattgtggtgatctaactttatct
gcagctattgctggtggatgtgagtttattgttttaccagaaatacatttcaaaaaagaa
gaattagttctggaaatacaagcaggaattactaaaggtaaaaaacatgctatcgttgca
attacagaatgtatttgtgatgtaaaagaattagcagaatatattgaacatcaaacaaaa
cgtgaaactagagctacaattcttggacatattcaaagaggtggatcgcctggagcttat
gatcgcatattagcttcaagaatgggagcttattcagtagaattattattaaaaggttat
aaaggtaaatgtgtaggaataaaaaatgataaaatagtttttaacgacattgaaaatgca
ttaaaaaatatgaaatatatttttaaaaaagaattattgatgactgctaaaaaactatac
taa

DBGET integrated database retrieval system