KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_544Help
Entry
BUAMB_544         CDS       T01830                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
buh00051  Fructose and mannose metabolism
buh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BUAMB_544 (mtlD)
Enzymes [BR:buh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BUAMB_544 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AEO08334
UniProt: G2LQ47
Position
complement(579277..580437)
Genome map
AA seq 386 aa AA seqDB search
MKALHFGAGNIGRGFIGKTLSESGFNVVFADLNQAIVNAINNKREYSVKTVGIDTYKITN
IKNVTAINCNNSKIFEEIVSVDLITTAVGVNALNNIAIIISKGIMLKIKKQCVKPLNIIA
CENKIKASSFLKKAILEILPNKHHHYLSQYIGFVDCSIDTIIPISKHNQSNLSIIAEEFK
EWIVNLNQFKGVIPKIIDMQLSNYLNPFIERKLLTLNTGHAVAAYLGLIKNYKTIQEAIQ
DPKIRIIVKYAMEESGSVLIKRYNFNKNHHLDYIKKIFLRFENNFLSDSLERIGRNPLQK
LGIEERLIKPILGSIEYKLPYSNLSKGVAAACHYLNVNDLESIKLTSSIKKEGIEKTLRN
ICNSKLIQEAICCIKKSYYEILREIK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactccattttggagctggaaatattggacgtggttttattggaaaaacatta
tcagaatctggatttaatgttgtttttgctgaccttaatcaagctatagttaatgcgatt
aataataaaagagaatattcagttaaaacagtaggtatcgatacatataagattactaat
atcaaaaatgttactgcgataaattgtaataactcaaagatttttgaagaaattgtttca
gttgatttaattactactgcagttggtgttaatgcattgaataatattgcgattattatt
tcaaaaggcattatgttaaaaattaaaaagcaatgtgtaaaaccgctaaatattattgcc
tgtgaaaataaaattaaagccagttcttttttgaaaaaagctattctagaaatattacct
aataaacatcatcattatttaagtcaatatataggttttgtagattgtagtatcgatact
attatacctatatcaaagcataatcaatctaatttatctatcattgctgaagaatttaaa
gagtggattgtaaatcttaatcaattcaaaggcgttatacctaaaattattgatatgcaa
ttgagtaattatttaaatccatttatcgaacgaaaattattaacgttaaatacaggacat
gctgttgcagcttatctaggtttaataaaaaactataaaacaatacaagaagctattcaa
gacccaaaaatacgaataattgttaaatatgctatggaagaaagcggatcagttttaata
aagcgttataattttaataaaaatcatcatttagattatattaaaaaaattttcctgcgc
tttgaaaataattttttatcagatagtcttgaaagaattggacgaaatccattgcaaaaa
ttagggatagaagaacgtctaatcaaacctattttaggaagcattgagtataaattaccc
tattctaatttatctaaaggtgttgcagctgcatgtcattatttgaatgtaaatgattta
gaatcaataaaactaacatcttcaattaaaaaagaaggtatagaaaagactttaagaaat
atttgtaattcaaagttaattcaagaagcaatatgttgtattaaaaaatcatattatgag
atattaagagaaataaaataa

DBGET integrated database retrieval system