KEGG   Burkholderia sp. PAMC 28687: AX768_06890Help
Entry
AX768_06890       CDS       T05699                                 

Definition
(GenBank) arylesterase
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.2.2 3.1.1.2 3.1.1.5]
Organism
bui  Burkholderia sp. PAMC 28687
Pathway
bui01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bui00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AX768_06890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bui01004]
    AX768_06890
Enzymes [BR:bui01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.2  arylesterase
     AX768_06890
    3.1.1.5  lysophospholipase
     AX768_06890
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     AX768_06890
    3.1.2.-  
     AX768_06890
Lipid biosynthesis proteins [BR:bui01004]
 Fatty acid synthase
  Component type
   AX768_06890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL OSK
Motif
Other DBs
NCBI-ProteinID: AMM13866
UniProt: A0A126YGG8
Position
1:complement(1491389..1492078)
Genome map
AA seq 229 aa AA seqDB search
MERLKVNWTPRATLALLAMAGCAATAPAQAADALAHTAMAAPAAPAIVVLGDSISAEYGL
PRDTGWVNLMRQKLMQERFDYSVANSSISGDTTSGGLARLPAALNRIKPKVVIVELGAND
ALRGVPLATTETNLRTIIEKSQAVHAKVLLVGMYVPPNYGPDYSQKFHAVYEKLSKEKQV
PLVPFLLAGMENKPEMFQADQIHPTPQAQPLLLNNVWPVLRPLLGTPSK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggagagacttaaggtgaactggacaccacgcgccacactggcgctgctggcgatggcc
ggatgcgcggccacggcgccggcacaagcggccgatgcgttggcccataccgcaatggcc
gcgcccgcggcgccggccattgtggtgctgggtgacagcatatcggcggaatacggcctg
ccgcgcgatacaggatgggtcaacctgatgcggcagaagctgatgcaagagcgcttcgat
tatagcgtcgccaattcaagcatcagcggcgacacgaccagcggcggcctcgcccgcctg
cccgctgcgctcaaccggatcaagccgaaggtggtgatcgtggaactgggcgccaacgac
gcgttacgcggcgtcccactagccaccaccgaaaccaacctgcgcacgatcatcgagaaa
tcgcaggcggtccatgcgaaggttttactcgtcggcatgtacgttccgcctaactatggc
ccggactactcgcaaaaattccacgccgtgtacgaaaagttatcgaaggagaaacaggtg
ccgctcgtcccgttcctgcttgcaggcatggagaacaagcctgaaatgttccaggcagac
caaattcatccgacccctcaggcccagcctttgctattgaacaacgtctggccagttttg
agacctttgctgggcacgccatcgaaatga

DBGET integrated database retrieval system