KEGG   Burkholderia sp. PAMC 28687: AX768_11680
Entry
AX768_11680       CDS       T05699                                 

Gene name
cpsB
Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bui  Burkholderia sp. PAMC 28687
Pathway
bui00051  Fructose and mannose metabolism
bui00520  Amino sugar and nucleotide sugar metabolism
bui00541  O-Antigen nucleotide sugar biosynthesis
bui01100  Metabolic pathways
bui01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AX768_11680 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    AX768_11680 (cpsB)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    AX768_11680 (cpsB)
Enzymes [BR:bui01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AX768_11680 (cpsB)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     AX768_11680 (cpsB)
SSDB
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Other DBs
NCBI-ProteinID: AMM14665
Position
1:complement(2517503..2519017)
AA seq 504 aa
MNTKVRQGEGDVVTGAEGLPADCRRLVQVVLAGGSGTRLWPVSRENFPKQLIGVVGAESL
LQATVLRMKGFPAAWDVAAEPVIVCGEEHRFATAEQVRDSGASARIVVEPARRDTAPALT
LAALTACADGQDAILVAMPADHAIADVPALHAAIDTAARHAQAGEIATLGIPPTRPDTGF
GYIRLGDALKDGAHRIDRFVEKPAAELAAQYVASGNFWWNSGIFIVRASVWLAALEKLQP
EMYAACVLSHEQAINTDEYLRPCAASFQKSPCDSIDYAVMEHLGKPDSPFMGVVVPLQAG
WSDLGSWDAVWDAMDKDEEGNASSGRVLFEGSTASYARSEGGRLVACVGTNNLIVVETDD
AVLVADRSRVQDIKGLVSRIKREKAPEADTHRKVRRPWGFYDSIDHGERFQVKRIVVNPG
ARLSLQMHHHRAEHWIVVSGTALVTRGEEEFLLSENESTYIPLGVRHRLENPGRVPLEII
EVQSGTYLGEDDIVRFDDKYGRCS
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgaacacgaaggtgaggcagggagaaggagacgtagtcacgggcgccgaaggattgcca
gctgactgccggcgtctcgttcaggtggtcctggcaggcggctcaggcacgcgcttgtgg
cccgtatcgcgcgaaaactttccaaagcaactcattggcgttgtaggcgccgagtccttg
ctgcaagcaaccgtattgcgcatgaagggttttcccgctgcatgggacgtcgccgcggaa
cctgtgatcgtatgcggcgaagaacatcgctttgccacggctgaacaggttcgcgacagc
ggcgcgagcgcgcggatcgtggttgaacctgcgcgccgcgatacggcgcccgcactcacg
ctcgcagcgctcaccgcttgcgccgacggccaggacgcgatcctcgttgccatgcctgcc
gatcacgcgattgcagacgtgccggcactgcatgccgccatcgataccgccgcgcgtcac
gcgcaagccggcgagatcgccacgctcgggattccgccaacacgaccggacaccggcttc
ggctacatccgtctgggcgacgcgctgaaagacggcgcgcatcgcatcgaccgttttgtc
gagaagccggcagccgaactcgccgcgcaatacgtcgcatccggtaatttctggtggaac
agcggcatcttcattgtgcgtgcatcggtatggcttgccgctctggaaaagctccagccg
gagatgtacgcggcatgtgtcttgtcgcacgaacaagcgattaacactgacgaatacttg
cgtccatgtgctgcatcgtttcagaaatcgccatgtgactccatcgattacgcggtgatg
gagcatcttggcaagcccgattcgcctttcatgggtgtggtcgtgccgcttcaagctggc
tggtccgatctcggctcatgggatgcggtctgggatgcgatggacaaggacgaggaaggc
aacgcgtcaagcggccgggtgttgttcgaaggatcgaccgcgagttatgcgcgttcggaa
ggcggcaggctggtcgcgtgtgtcgggacgaacaacctgatcgtggtcgagaccgatgac
gctgttcttgtggctgaccgctcacgcgttcaggacatcaagggcctcgtgtcgcggatc
aagcgcgagaaggcgcccgaagccgatacacacagaaaggttcgccgtccctggggtttt
tacgattccatcgaccatggcgagcgcttccaggttaaacgcatcgtggtgaatccgggt
gcgcgcctgtcgctgcaaatgcatcaccaccgcgcggagcattggatcgttgtgagtggc
acggccctcgtgacgcgcggagaagaagagtttctgctgagcgaaaacgaatcgacctac
atcccgctcggtgtgcgtcatcgcctggaaaacccgggtcgcgtgccgctcgaaatcatt
gaagtgcagtcagggacctacctcggcgaagacgacatcgtcagatttgacgacaagtac
ggccggtgcagttaa

DBGET integrated database retrieval system