KEGG   Burkholderia sp. PAMC 28687: AX768_11680Help
Entry
AX768_11680       CDS       T05699                                 

Gene name
cpsB
Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bui  Burkholderia sp. PAMC 28687
Pathway
bui00051  Fructose and mannose metabolism
bui00520  Amino sugar and nucleotide sugar metabolism
bui01100  Metabolic pathways
bui01110  Biosynthesis of secondary metabolites
bui01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AX768_11680 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    AX768_11680 (cpsB)
Enzymes [BR:bui01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AX768_11680 (cpsB)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     AX768_11680 (cpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AMM14665
Position
1:complement(2517503..2519017)
Genome map
AA seq 504 aa AA seqDB search
MNTKVRQGEGDVVTGAEGLPADCRRLVQVVLAGGSGTRLWPVSRENFPKQLIGVVGAESL
LQATVLRMKGFPAAWDVAAEPVIVCGEEHRFATAEQVRDSGASARIVVEPARRDTAPALT
LAALTACADGQDAILVAMPADHAIADVPALHAAIDTAARHAQAGEIATLGIPPTRPDTGF
GYIRLGDALKDGAHRIDRFVEKPAAELAAQYVASGNFWWNSGIFIVRASVWLAALEKLQP
EMYAACVLSHEQAINTDEYLRPCAASFQKSPCDSIDYAVMEHLGKPDSPFMGVVVPLQAG
WSDLGSWDAVWDAMDKDEEGNASSGRVLFEGSTASYARSEGGRLVACVGTNNLIVVETDD
AVLVADRSRVQDIKGLVSRIKREKAPEADTHRKVRRPWGFYDSIDHGERFQVKRIVVNPG
ARLSLQMHHHRAEHWIVVSGTALVTRGEEEFLLSENESTYIPLGVRHRLENPGRVPLEII
EVQSGTYLGEDDIVRFDDKYGRCS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgaaggtgaggcagggagaaggagacgtagtcacgggcgccgaaggattgcca
gctgactgccggcgtctcgttcaggtggtcctggcaggcggctcaggcacgcgcttgtgg
cccgtatcgcgcgaaaactttccaaagcaactcattggcgttgtaggcgccgagtccttg
ctgcaagcaaccgtattgcgcatgaagggttttcccgctgcatgggacgtcgccgcggaa
cctgtgatcgtatgcggcgaagaacatcgctttgccacggctgaacaggttcgcgacagc
ggcgcgagcgcgcggatcgtggttgaacctgcgcgccgcgatacggcgcccgcactcacg
ctcgcagcgctcaccgcttgcgccgacggccaggacgcgatcctcgttgccatgcctgcc
gatcacgcgattgcagacgtgccggcactgcatgccgccatcgataccgccgcgcgtcac
gcgcaagccggcgagatcgccacgctcgggattccgccaacacgaccggacaccggcttc
ggctacatccgtctgggcgacgcgctgaaagacggcgcgcatcgcatcgaccgttttgtc
gagaagccggcagccgaactcgccgcgcaatacgtcgcatccggtaatttctggtggaac
agcggcatcttcattgtgcgtgcatcggtatggcttgccgctctggaaaagctccagccg
gagatgtacgcggcatgtgtcttgtcgcacgaacaagcgattaacactgacgaatacttg
cgtccatgtgctgcatcgtttcagaaatcgccatgtgactccatcgattacgcggtgatg
gagcatcttggcaagcccgattcgcctttcatgggtgtggtcgtgccgcttcaagctggc
tggtccgatctcggctcatgggatgcggtctgggatgcgatggacaaggacgaggaaggc
aacgcgtcaagcggccgggtgttgttcgaaggatcgaccgcgagttatgcgcgttcggaa
ggcggcaggctggtcgcgtgtgtcgggacgaacaacctgatcgtggtcgagaccgatgac
gctgttcttgtggctgaccgctcacgcgttcaggacatcaagggcctcgtgtcgcggatc
aagcgcgagaaggcgcccgaagccgatacacacagaaaggttcgccgtccctggggtttt
tacgattccatcgaccatggcgagcgcttccaggttaaacgcatcgtggtgaatccgggt
gcgcgcctgtcgctgcaaatgcatcaccaccgcgcggagcattggatcgttgtgagtggc
acggccctcgtgacgcgcggagaagaagagtttctgctgagcgaaaacgaatcgacctac
atcccgctcggtgtgcgtcatcgcctggaaaacccgggtcgcgtgccgctcgaaatcatt
gaagtgcagtcagggacctacctcggcgaagacgacatcgtcagatttgacgacaagtac
ggccggtgcagttaa

DBGET integrated database retrieval system