KEGG   Burkholderia sp. PAMC 28687: AX768_12685Help
Entry
AX768_12685       CDS       T05699                                 

Definition
(GenBank) carnitine dehydratase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bui  Burkholderia sp. PAMC 28687
Pathway
bui00010  Glycolysis / Gluconeogenesis
bui00053  Ascorbate and aldarate metabolism
bui00071  Fatty acid degradation
bui00280  Valine, leucine and isoleucine degradation
bui00310  Lysine degradation
bui00330  Arginine and proline metabolism
bui00340  Histidine metabolism
bui00380  Tryptophan metabolism
bui00410  beta-Alanine metabolism
bui00561  Glycerolipid metabolism
bui00620  Pyruvate metabolism
bui00625  Chloroalkane and chloroalkene degradation
bui00903  Limonene and pinene degradation
bui01100  Metabolic pathways
bui01110  Biosynthesis of secondary metabolites
bui01120  Microbial metabolism in diverse environments
bui01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AX768_12685
   00053 Ascorbate and aldarate metabolism
    AX768_12685
   00620 Pyruvate metabolism
    AX768_12685
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AX768_12685
   00561 Glycerolipid metabolism
    AX768_12685
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AX768_12685
   00310 Lysine degradation
    AX768_12685
   00330 Arginine and proline metabolism
    AX768_12685
   00340 Histidine metabolism
    AX768_12685
   00380 Tryptophan metabolism
    AX768_12685
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AX768_12685
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AX768_12685
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AX768_12685
Enzymes [BR:bui01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AX768_12685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMM14823
UniProt: A0A126YIP2
Position
1:complement(2740332..2741843)
Genome map
AA seq 503 aa AA seqDB search
MKTTVESLQGSRQDLFIHGEFVAPRSGHYVSSYDPTTAEPWYQFAQANADDVDAAVRSAQ
AALKNPAWRRITQTDRGKLVRRLAELVLANADELALIECRDNGKLIKEMRAQMRAIPDSY
QYFAGMADKLQGDTIPVNKLDTLNFNLREPIGVVGMIIPWNSPLMMLTGTLAPCLAIGNT
VVVKPSEHATASTLALAELAIEAGIPPGVFNVVTGDGVTTGDALTRHPGVAKFVFTGSTM
TGRKIAGNAAQNLVPCQMELGGKSPHVVFSDVDVERAVNGVVSGVFAAAGQTCVAGSRCF
VEAPIYERFVDALVERTRRVKVGHPMADDTDIGPLALASQLDKVEGYVASGVHEGAKIAV
GGRKPKDSALSKGWYFEPTVMTQARNEMRFMQEEIFGPVVGVVPFNTEEELIALANDTEY
GLASGIWTQDIDRALRFARDIEAGTVWINTYRSAAYMSANGGTKRSGYGRRGGFEVMREF
SRVKNVVIDYSGAMQDPFVIRLR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgacagtcgaaagtttgcaggggtccaggcaagacctgttcatccacggcgag
ttcgtggcgccacgcagcggccactacgtgtcgagctacgatccgaccaccgccgagccc
tggtatcaattcgcgcaagccaatgccgacgatgtggatgccgccgtgcgctctgcgcaa
gccgcattgaagaacccggcttggcgccgcatcacgcaaaccgatcgcggcaagctcgtg
cgccgtcttgccgaactcgtgctcgccaacgccgatgaactcgcgctgatcgaatgccgc
gacaacggcaagctgatcaaggaaatgcgcgcgcagatgcgggcgatccctgattcatat
cagtacttcgccggcatggccgacaagctgcaaggcgacacgattcccgtcaacaagctc
gacacgctcaacttcaacttgcgtgaaccgataggtgtggtcggcatgatcatcccctgg
aactcgccgctgatgatgctcacgggcacgctcgcgccgtgtctcgcgatcggcaacacg
gtggtcgtgaagccttcggaacacgcgacagcatcgacactggcgctggccgaacttgcg
atcgaagcgggcattccgccgggcgtgttcaacgtcgtgaccggcgatggcgtcactacc
ggcgacgcgctcacgcgtcacccgggcgtcgcgaagttcgtgttcacgggcagcacgatg
accggccgcaagatcgcgggcaatgcggcgcagaacctggtgccgtgccagatggaactc
gggggcaagtcgccacatgtggtgttctcggacgtggatgtcgagcgcgcggtgaacggc
gtcgtgtcgggcgtatttgcggcggctgggcagacatgcgtggcgggttcgcggtgcttt
gtcgaggcgccgatctacgaacgcttcgtggatgcactggtcgagcgcacgcgtcgcgta
aaagtaggccaccccatggccgacgataccgacatcggtcccctagcgctcgccagccag
ctcgacaaggtcgaaggttacgttgcgtccggcgtgcatgagggcgcgaagatcgcggtc
ggcggacgcaagccgaaggactcggcgttatcgaagggatggtatttcgagccgaccgtc
atgacgcaagcgcgcaacgaaatgcgcttcatgcaggaagagatcttcgggccagtcgtg
ggcgtggttccgttcaacacagaagaagagctcatcgcgctcgccaacgataccgaatac
ggcctcgcctccggcatctggacgcaggacatcgaccgtgcgttgcgctttgcgcgtgac
attgaagcgggtacggtctggatcaatacgtatcggtcggccgcgtacatgtcagctaat
ggcggcacgaagcgcagcggttacggacgtcgcggcggcttcgaagtaatgcgcgaattc
tcgcgcgtgaagaacgtggtgatcgattactcgggcgcgatgcaagacccgttcgtgatc
cgcctgcgctaa

DBGET integrated database retrieval system