KEGG   Burkholderia sp. PAMC 28687: AX768_18010Help
Entry
AX768_18010       CDS       T05699                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bui  Burkholderia sp. PAMC 28687
Pathway
bui00260  Glycine, serine and threonine metabolism
bui01100  Metabolic pathways
bui01110  Biosynthesis of secondary metabolites
bui01120  Microbial metabolism in diverse environments
bui01130  Biosynthesis of antibiotics
bui01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bui00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AX768_18010
Enzymes [BR:bui01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AX768_18010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AMM16116
Position
2:complement(581905..582972)
Genome map
AA seq 355 aa AA seqDB search
MNQQAVSTHKEPALGFSSDNIAGASPEVLEAMVDCNTGQSAPYGGDALTARVERKLAELF
ERDVDVFLVPTGTTANALCLAAMTPPWGSVFCHPSSHVNNDECGAPEFYTNGAKLISVDG
PSAKIDPVNLRKAANVKVGDVHVTQPSCVSITQATEVGSIYSLDEIRELGDLCRASSIGL
HMDGSRFANALVSLDCTPAEMTWKAGVDALSFGATKNGVPCAEAIVLFDKKLAAEMGYRR
KRAGHLFSKMRFLSAQMDAYLTDDLWLRNARQANDTARRLQDGIKDLEGVEIFGAPQANI
LFCRLPAAVIEGLLAAGFVFYHDRWEPGVVRFVTSFATTTEDVDNLIANVARLAG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagcaagctgtatcgacacacaaagaacccgccctcggcttctcgagcgacaac
atcgccggagcttcgccggaagtcctcgaagccatggtggactgcaacacgggccagtca
gcgccttacggcggcgatgcgctcacggcgcgcgtcgaacgcaagcttgccgaactgttc
gagcgcgacgtggatgtgttcctcgtgcctactggaacgacggcaaacgcgttgtgcctc
gcggccatgacgccgccctggggcagcgtcttttgccacccgtcaagtcacgtcaacaat
gacgaatgcggcgcgcccgagttttatacgaacggcgcgaagttgatttctgtcgacggg
ccgtccgcgaagatcgaccccgtgaacctgcgcaaggccgcgaacgtcaaggtcggcgac
gtccacgtgacgcagccttcgtgcgtcagcatcacgcaagctacggaagtgggcagcatc
tacagcctcgatgaaatccgcgaactgggcgacctctgccgcgcatcctcgatcggcctg
cacatggacggttcgcgctttgcgaatgcactcgtctcgctcgattgcacgcccgctgaa
atgacatggaaagcaggcgtcgacgcgctgtcttttggcgcaacaaaaaatggtgttcca
tgcgctgaagccatcgttttgttcgataaaaaactggccgccgagatgggttaccggcgc
aagcgcgccggccatctgttctccaagatgcgctttctttcagcacagatggacgcgtat
ctgaccgatgatctatggctgcgcaacgcacgccaggcaaacgacaccgcccggcgcctt
caggacggcatcaaggacctggagggcgtggagatcttcggcgcgccgcaagcgaacatt
ctcttctgccgcttgccggcagcggtcattgaagggcttctggcagcggggttcgtgttc
taccacgaccgatgggaaccgggcgtggtgcgcttcgtgacgtcgttcgcgacgaccact
gaagacgtcgataacctgatcgccaacgtcgcgcggcttgccggttaa

DBGET integrated database retrieval system