KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0117Help
Entry
BurJV3_0117       CDS       T01596                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00071  Fatty acid degradation
buj00072  Synthesis and degradation of ketone bodies
buj00280  Valine, leucine and isoleucine degradation
buj00310  Lysine degradation
buj00362  Benzoate degradation
buj00380  Tryptophan metabolism
buj00620  Pyruvate metabolism
buj00630  Glyoxylate and dicarboxylate metabolism
buj00640  Propanoate metabolism
buj00650  Butanoate metabolism
buj00900  Terpenoid backbone biosynthesis
buj01100  Metabolic pathways
buj01110  Biosynthesis of secondary metabolites
buj01120  Microbial metabolism in diverse environments
buj01130  Biosynthesis of antibiotics
buj01200  Carbon metabolism
buj01212  Fatty acid metabolism
buj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BurJV3_0117
   00630 Glyoxylate and dicarboxylate metabolism
    BurJV3_0117
   00640 Propanoate metabolism
    BurJV3_0117
   00650 Butanoate metabolism
    BurJV3_0117
  Lipid metabolism
   00071 Fatty acid degradation
    BurJV3_0117
   00072 Synthesis and degradation of ketone bodies
    BurJV3_0117
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BurJV3_0117
   00310 Lysine degradation
    BurJV3_0117
   00380 Tryptophan metabolism
    BurJV3_0117
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BurJV3_0117
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BurJV3_0117
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BurJV3_0117
Enzymes [BR:buj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BurJV3_0117
Exosome [BR:buj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BurJV3_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C DDE_Tnp_IS66_C
Motif
Other DBs
NCBI-ProteinID: AEM49453
UniProt: G0K3P3
Position
135620..136900
Genome map
AA seq 426 aa AA seqDB search
MPNARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGALVERFGLHGQQLGEVAMGAVI
KHSSDWNLGREATLSSGLSPLTPGITLQRACGTSLDSIITVANKIALGQIESGIGGGSDT
TSDVPIVYGKKLRARLLAANRARSTGDKIRALTAGFKFSELKPEFPGVAEPRTGKSMGDH
CEDMAKEWNISRDSQDEWAVSSHKKLAAAYERGFFNDLIAPFRGVERDNILRPDTSLEKL
ATLKPAFDKVSGRGTLTAANSTPLTDGAAAVLLASEEWARAHGHEPQAYLRDAHVSAVDF
VHGEGLLMAPTVAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNRLGL
DAPMGRIDPDKINLLGSSLATGHPFAATGARVIATAAKQLAERGGGRALVSICTAGGMGV
VAIVER
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgctcgtcccgtcgccatcctcggtggcgtccgcattccgttctgccgccag
aacaccgcgtattcggatgtcggcaacctcggcatgtcggtccgtacgctgggcgcgctg
gtcgaacgtttcggcctgcatggccagcagctgggcgaagtggcgatgggtgcggtgatc
aagcactccagcgactggaacctgggccgcgaagccacgctgtcttccggcctgtcgccg
ttgaccccgggcatcaccctgcagcgcgcctgtggcacctcgctggacagcatcatcacc
gtcgccaacaagatcgcgctgggccagatcgaatcgggcatcggcggcggttcggacacc
acctccgacgtgccgatcgtctacggcaagaagctgcgcgcgcgcctgctggctgccaac
cgtgccaggagcaccggcgacaagatccgtgcgcttaccgccggcttcaagttctccgag
ctcaagcccgagttcccaggcgtggccgagccgcgcaccggcaagagcatgggcgaccac
tgcgaggacatggccaaggagtggaacatctcgcgcgactcgcaggacgagtgggcggtg
tcgtcgcacaagaagctggccgcagcctatgagcgcggcttcttcaatgacctgatcgca
ccgttccgtggcgtcgagcgcgacaacatcctgcgcccggatacctcgctggaaaagctg
gcgacgctgaagccggcgttcgacaaggtctccggccgcggcacgctgaccgccgccaac
tccaccccgctgaccgatggcgccgccgccgtgctgctggccagcgaagagtgggcgcgt
gcgcacggccatgagccgcaggcctatctgcgcgatgcgcatgtctctgcggtggacttc
gtgcatggcgaaggcctgctgatggcaccgaccgtggccgtgccggagatgctcaagcgc
aacggcctgaccctgcaggacttcgacatctacgagatccacgaagccttcgccgcgcag
gtgctgtgcacgctgcgtgcgtgggagagcgaggattactgccgcaaccgcctgggcctg
gacgcgccgatgggccgcatcgacccggacaagatcaacctgctgggctcgtcgctggcc
accggccacccgtttgcagccactggcgcacgcgtgatcgccaccgccgccaagcagttg
gccgagcgcggcggcggccgtgcgctggtgtcgatctgcaccgccggcggcatgggtgta
gtggcgatcgtcgagcgctga

DBGET integrated database retrieval system