KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0548Help
Entry
BurJV3_0548       CDS       T01596                                 

Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00230  Purine metabolism
buj00240  Pyrimidine metabolism
buj01100  Metabolic pathways
buj03030  DNA replication
buj03430  Mismatch repair
buj03440  Homologous recombination
Module
buj_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BurJV3_0548
   00240 Pyrimidine metabolism
    BurJV3_0548
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BurJV3_0548
   03430 Mismatch repair
    BurJV3_0548
   03440 Homologous recombination
    BurJV3_0548
Enzymes [BR:buj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BurJV3_0548
DNA replication proteins [BR:buj03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BurJV3_0548
DNA repair and recombination proteins [BR:buj03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     BurJV3_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AEM49882
UniProt: G0JWZ4
Position
complement(613994..614419)
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLTEPLRLVCELARKANDAGLFTLVLARDQAQAEELDELLWAFDNDA
YIPHQIAGEDMDEEEALVLIAVPGTEAPARPLVINLRDEPWLGQCERVLEVVPADPEARE
PLRERWRQYKAAGYDLNKHDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgccgacttctacctgatcgccaagccccgcttcctgaccgagccgttgcgc
ctggtctgcgaactggcgcgcaaggccaacgacgccgggctgttcaccctggtgctggcc
cgtgaccaggcccaggccgaggaactggacgagctgctgtgggcgttcgacaacgatgcc
tacatcccgcaccagatcgccggggaagacatggacgaggaggaggccctggtgctgatc
gccgtgcccggcaccgaggcaccggcacgtccgctggtgatcaacctgcgcgacgagccc
tggctgggccagtgcgagcgcgtgctggaagtggttccggccgatccggaagcgcgcgaa
ccgctgcgcgagcgctggcgccagtacaaggccgccgggtacgacctgaacaagcacgac
atgtaa

DBGET integrated database retrieval system