KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1916Help
Entry
BurJV3_1916       CDS       T01596                                 

Definition
(GenBank) CheA signal transduction histidine kinase
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj02020  Two-component system
buj02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:buj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BurJV3_1916
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BurJV3_1916
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:buj01001]
    BurJV3_1916
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:buj02022]
    BurJV3_1916
   02035 Bacterial motility proteins [BR:buj02035]
    BurJV3_1916
Enzymes [BR:buj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BurJV3_1916
Protein kinases [BR:buj01001]
 Histidine kinases
  CheA family [OT]
   BurJV3_1916
Two-component system [BR:buj02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   BurJV3_1916
Bacterial motility proteins [BR:buj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BurJV3_1916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW HATPase_c Hpt H-kinase_dim SHOCT HATPase_c_3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AEM51241
Position
complement(2116137..2117981)
Genome map
AA seq 614 aa AA seqDB search
MSAVSDDITADFIIEAQEILDRLGEQLVSLEQAPQDTEQLNAVFRGYHTLKGGAGFLGVT
AMVELCHAAEEALGAARAGQAMLQAHHFDAAQQSLDYLQSMLDAVSSGTEPGYAPPDLIA
QFDVHGGAVAAPAAAAAPAAGGSDLITDDEFEALLDQLHGGNAPTAVAPAKKADDGLISE
DEFEALLDQLHGGAAPGAKPAAAAAPAPIAAPRPATAPAPAAKPAAKPLAEAEHTVRVDT
KRLDAIVNLIGELVLSRNRLKTLRARLRDEELDRAVSTLDIATARLQSAVMRTRMQPVGK
VFSRFPKVARDVARSLKKEVDLELIGAETELDRNLVEALADPLVHLVRNAIDHGVEMPDL
REAQGKPRMGHVRLSAQQEGDYVSIEVQDDGAGIDPEKLRAKAREKGLIDPEAAARLSSE
ECLHLVFLPGFSTKQQVTDISGRGVGMDVVQSRIRELSGQIQIQSELGRGSRFLIRVPLT
LAILPTLLVQAGEDVYALPLARVMEVLHAPRTSLGWFDGRAVLDRRSHTLPLVDLRQWLD
VTPAASTLLTIVVLQAGEARFGLVVDQVRGREEVVIKPLPKALRGLRGYAGATLIGDGRM
ALILDVDGLRSPHD
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggtatccgacgacatcactgccgatttcatcatcgaggcacaggaaatcctg
gatcgcctcggcgaacagctggtgtcgctggagcaggcaccgcaggacaccgaacagctc
aacgcggtgttccggggctaccacacactcaagggcggcgctggattcctcggtgtcacc
gccatggtcgagctgtgccacgccgctgaagaagcgctgggcgctgcacgtgccggccag
gccatgctgcaggcccatcacttcgacgccgcccagcaatcgctggattacctgcagtca
atgctggacgccgtgtcttccggcaccgagccgggctatgcaccgccagacctgatcgcc
cagttcgacgtgcatggcggtgccgtggctgcacccgccgccgccgcagctcccgctgcg
ggtggcagcgacctgatcaccgacgacgagttcgaggccctgctcgaccagctgcacggc
ggcaacgcaccgaccgcggtggcgccggcaaagaaggccgacgacgggctgatcagcgag
gacgagttcgaagctctgctcgaccagctgcatggcggcgccgcacccggcgccaagcct
gcggctgcggcggcaccggcaccgatcgccgccccgcgcccggcgaccgcaccggcaccg
gcggccaagccggccgccaaaccgctggccgaagccgaacacaccgtgcgcgtggacacc
aagcgcctggacgcgatcgtcaacttgatcggtgaactggtgctgtcgcgcaaccggctc
aagaccctgcgtgcgcgcctgcgcgacgaggagctggaccgcgccgtgtccaccctggac
atcgccaccgcgcgcctgcagtcggcggtgatgcgcacccgcatgcagccggtgggcaag
gtgttctcgcgcttccccaaggtcgcccgcgacgtcgcccgctcgctgaagaaggaagtg
gacctggagctgatcggcgccgagaccgagctcgaccgcaacctggtcgaagcgctggcc
gacccgctggtgcacctggtccgcaacgccatcgatcatggcgtggaaatgcccgacctg
cgcgaagcacagggcaagccgcggatgggccatgtgcggttgtcggcgcagcaggaaggt
gactacgtcagcatcgaggtgcaggacgatggcgccggcatcgacccggaaaagctgcgc
gcgaaggcgcgcgagaagggcctgatcgatccggaggccgccgcccgcctgagcagcgag
gagtgcctgcacctggtgttcctgcccggcttctcgaccaagcagcaggtcacggatatt
tccggccgcggcgttggcatggacgtggtgcagtcgcgcatccgcgaactgagcggccag
atccagatccagtcggagctgggccgcggcagtcgtttcctgatccgcgtgccgctcacc
ctggcgatcctgccgaccctgctggtgcaggccggcgaggacgtctatgcgctgccgctg
gcgcgcgtgatggaagtgctgcacgcaccgcgcacctcgctgggctggttcgatggccgc
gccgtgctcgaccgccgttcgcacacgctgccactggtcgatctgcgccagtggctggat
gtgacgcccgccgcgtcgaccctgctgaccatcgtggtgctgcaggccggcgaagcgcgc
ttcggcctggtcgtggaccaggtgcgcgggcgcgaggaagtggtcatcaagccactgccg
aaagccctgcgcggcctgcgcggttacgccggtgcaaccttgatcggcgatggtcgcatg
gcgctgatcctggatgtggacggcctgcgcagcccgcacgactga

DBGET integrated database retrieval system