KEGG   Stenotrophomonas maltophilia JV3: BurJV3_2512Help
Entry
BurJV3_2512       CDS       T01596                                 

Definition
(GenBank) conjugation TrbI family protein
  KO
K03195  type IV secretion system protein VirB10
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:buj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BurJV3_2512
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buj02044]
    BurJV3_2512
Secretion system [BR:buj02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BurJV3_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI
Motif
Other DBs
NCBI-ProteinID: AEM51832
Position
complement(2768815..2770086)
Genome map
AA seq 423 aa AA seqDB search
MSQQNTPGNDPNNGRDESQSPYGAQGAPDAQSNPYFGTTQAEPAPDLDAAAPQLRSAEEQ
RLNRKALLFLGGIVLLLMAMGFLLFRKGQDDKDAVQKVPDVARATTPTLPDAVQTSPVPS
QAMQPVDPIPMTPPLPPPPLDSTPLFVPQSDSAREMDRGPTLLDRRIGSGSGVGGGDGQD
GNGGNGGRGMDEYTRTMLAQLPNNQAAPAKVRRGPDVEDVSSATYIQSPDALLVRGTYLR
CVLETRIITDLAGYTSCLLTEPVYSINGRNLLLPKGSKIYGAYGGGPMGKRVEVIWDRIT
TPNGIDVAMSSPGVDQLGGAGHPGQYSAHWGSRIASALMISLISDAFKYAAAEHGPETTT
IANNGMTVQSPYESATARTMERLANEALSSNRRPPTVTINQGTIVNVYVAKDVDFTNVLH
PRR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcagaacactcccggaaacgacccgaacaacggacgcgacgagagccagagc
ccgtacggcgcacaaggtgccccggacgcgcagtcgaacccgtacttcggcacgacccag
gccgagcctgcgccggatctggatgcggccgcaccgcagctgcgctcggccgaagagcag
cggctgaaccgcaaggcgctgctgttccttggcggcatcgtgctgctgctgatggcgatg
ggcttcctgctgttccgcaagggccaggatgacaaggatgctgtgcagaaggtgccggat
gtcgcgcgcgccaccacgccgactctgccggacgccgtgcagacgagtccggtgccctcc
caggccatgcaaccggttgatccgattccgatgacgccgccgctaccgccgccgccgctg
gattccaccccgctgttcgttccccagtccgattcggcacgcgagatggaccgtggcccg
actttgctggaccgccgcatcggctccgggagcggggtgggtggtggtgatggacaggat
ggcaacgggggcaatggcggccgcggcatggatgagtacacccgtaccatgctggcccag
ctgcccaacaatcaggcggcgccggcaaaggtccgtcgtgggccggacgtggaagacgtc
tccagtgccacctacatccagagccccgatgcgctgctggtgcgtggcacctacctgcgt
tgcgtgctggaaacccgcatcatcaccgatctcgccggctatacctcgtgcctgctgacc
gagccggtgtactcgatcaatggtcgcaacctgctgctgccgaagggctccaagatctat
ggcgcttacggcggcggtccgatgggcaagcgcgtggaagtgatctgggatcgcatcacc
acccccaatggcatcgatgttgcgatgtccagcccgggcgtggatcagctgggtggcgcc
ggtcatccgggccagtacagcgcgcactggggcagccgtatcgcctcggcgctgatgatc
agcctgatttccgatgccttcaagtacgcagccgccgaacacggtccggagacgaccacc
atcgccaacaatggcatgacggtgcagtcgccctatgagagtgctaccgcacgcacgatg
gagcgcctggccaacgaggccctcagcagcaaccgtcgtccgccgaccgtcaccatcaac
cagggcacgatcgtgaacgtctacgttgccaaggacgtcgacttcaccaacgtgctccac
ccccgccggtaa

DBGET integrated database retrieval system