KEGG   Stenotrophomonas maltophilia JV3: BurJV3_2858Help
Entry
BurJV3_2858       CDS       T01596                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00010  Glycolysis / Gluconeogenesis
buj00051  Fructose and mannose metabolism
buj00562  Inositol phosphate metabolism
buj01100  Metabolic pathways
buj01110  Biosynthesis of secondary metabolites
buj01120  Microbial metabolism in diverse environments
buj01130  Biosynthesis of antibiotics
buj01200  Carbon metabolism
buj01230  Biosynthesis of amino acids
Module
buj_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BurJV3_2858
   00051 Fructose and mannose metabolism
    BurJV3_2858
   00562 Inositol phosphate metabolism
    BurJV3_2858
Enzymes [BR:buj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BurJV3_2858
Exosome [BR:buj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BurJV3_2858
  Exosomal proteins of bladder cancer cells
   BurJV3_2858
  Exosomal proteins of melanoma cells
   BurJV3_2858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEM52177
UniProt: G0JXE8
Position
complement(3134218..3134973)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGSRQFANELLGQVAAGLPLEGVDVVILPPLPYLGELVEDFGETGLAF
GAQDVSSNEKGAYTGEVCAAMLVEVGARYGLVGHSERRQYHHESSELVARKFAAAQHAGL
VPVLCVGETLEQREAGQTETVIASQLAPVLELVGAAGFAKAVVAYEPVWAIGTGRTASKE
QAQQVHAFIRGEVARIDARIADSLPIVYGGSVKPDNAGELFAQPDVDGGLVGGASLVAAD
FLAIARAAAAN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcaagatcgtcgccggaaactggaagctgcatggcagccgtcaattcgccaat
gaactgctggggcaggtggccgccgggctgccgctggagggggtggacgtggtgatcctg
ccgccgctgccgtacctgggcgagctggtcgaggacttcggcgagaccggcctggccttc
ggcgcgcaggacgtgagcagcaacgagaagggcgcctataccggcgaggtctgcgcggcc
atgctggtcgaggtcggggcccgctatggcctggtcggccactccgagcgccgccagtac
catcatgaaagcagcgagctggtcgcgcgcaagttcgccgccgcccagcatgccggcctg
gtgccggtgctgtgcgtgggcgagaccctggagcagcgcgaggccgggcagaccgaaacg
gtcatcgccagccagctggcgccggtgctggagctggtcggcgcggccggtttcgccaaa
gccgtggtcgcctacgagccggtctgggccatcggcaccggccgtaccgccagcaaggag
caggcgcagcaggtgcacgcgttcatccgtggcgaagtcgcgcgtatcgatgctagaatt
gctgattcactgcccattgtttacggcggtagcgtgaagcccgacaatgccggggaactg
ttcgcgcagccggatgtcgatggtgggctggtcggcggcgcctccctggtggccgcggac
ttcctggccatcgcacgggcggcggccgcgaactaa

DBGET integrated database retrieval system