KEGG   Stenotrophomonas maltophilia JV3: BurJV3_4060Help
Entry
BurJV3_4060       CDS       T01596                                 

Definition
(GenBank) exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:buj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BurJV3_4060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:buj03400]
    BurJV3_4060
Enzymes [BR:buj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BurJV3_4060
DNA repair and recombination proteins [BR:buj03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BurJV3_4060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 PDDEXK_1 AAA_11 AAA_22
Motif
Other DBs
NCBI-ProteinID: AEM53372
Position
complement(4511448..4515128)
Genome map
AA seq 1226 aa AA seqDB search
MSTAIVDEQSQRMAGDPYLALPLDGIRLIEASAGTGKTFTLATLFTRLVVEQGLRIGQIL
AVTFTDAATQELRKRIRERLALAARLVDLEPAEGEAPDASLTRDVLQRHLQVGTESAAAL
KRRLQVAADEIDLASIFTIHGFCTRVLREHALESGHTFDPPELLASDRELLEELAADLWR
VHANDPATLEPLTWLWSNPDALAADLRALLAAPPLHPLPRPVALADPQPALQATAAELQL
ALREHGEQFFIDLCDAVDNKWINGVSYKLGWLHTLGRQLLAWAGRADARELLASERLPAL
LPDVLADKTNKKFPDRTPSSPVQAPLARYVALLAERDAWLRATALNFLHALRAEAMQRLQ
ALKRTRRVQTYDDLIDGVALALEGPQRLALVRQLRAQYRIALVDEFQDTDDRQWGIFHTV
FGDSPEVRELGLAPALFLIGDPKQAIYGFRGGDIHTYLKAKQVAQQAPVLDQNFRSRPAV
LRALQALYDNGGEDAFLERDIQFEPVRPGGVRSDEDYLRDGHAATALTLRVLRSGGDKAM
SADASREAATQACVAAIHQILVEARAGKAVLRGQPVRPGDIAVLVRSHREATLVQRALAA
VGIPAVAAGKQSLFSTPEARDLRALLLALLQPADEGRLRAALATVLLGQRASAIAAMERE
GDLQRGFQAQLLHWRERWQRGGPFAVIADVCAAQGERLLALIDGERRLTNYLQLGELLQE
ASAQALGMHGLLDWLQGQMASADQDDEQQLLRLESDARRVQIITLHKSKGLEYPLVFLPF
VGIDGGAPNTASHCTVHVSGQRQLHWKLDKDEVWEAASAQREREQRAEDARLLYVGLTRA
EHALWIAAGDLAGLGRTRLAPLLGDLQALRAQADVHIDDSETPAALPQLAAEVEGDLPAV
RALTRRVPHDWWVYSFTQLAHADAGAGSDIEAAATELPAPAADEPAGPELPLEPALPEPA
AAAEDSVAVDPRFMGSRFGNVLHEAMENVDFAAWADWQPGLEAPEGQAEVLRKALHDEGY
ADVDLDDGVAVLVPLVGHTLTVPLPEGGALHSLGAGERRAEIDFHFAIEPTTVPALLQVL
HAHGVSSTRRGFGQRRRLEGLMTGMIDLTYVRDGRWYVLDYKSNRLPGYSPDLLAIAMRH
SEYDLQALIYTVALHRWLRFRLGAAYDYERDMGGIRYLFCRGLDAAGNGVHVDRFPLALV
DALDALFAGGEQAQAELAARARGASA
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccatcgtcgatgagcaatcccagcgcatggcgggcgatccctatctggcg
ctgccgctggatggcatccgcctgatcgaggccagcgccggtaccggcaagaccttcacc
ctggccacgctgttcacccgcctggtggtggagcagggcctgcgcatcggccagatcctg
gcggtgaccttcaccgatgccgccacccaggaactgcgcaagcgcatccgcgagcgcctg
gcgctggccgcgcgcctggtcgatctggaaccggccgagggcgaagcaccggacgcgagc
ttgacccgcgacgtactgcagcgccatctgcaggttggcaccgagagtgccgccgcgctg
aagcgacgcctgcaggttgccgccgatgagatcgacctggcgtcgatcttcaccatccac
ggcttctgtacccgcgtgctgcgcgagcatgcgctggaaagcggccacaccttcgacccg
ccggaactgctggccagcgaccgtgagctgctggaggagctggccgccgatctgtggcgg
gtgcacgccaacgacccggccacgctggaaccgctgacctggctgtggtccaaccccgat
gccctggccgccgatctgcgcgcgctgctggctgcgccgcctctgcacccgttgccacgg
ccggtggcgctggccgatccacagccggcattgcaggccaccgccgccgaactgcagctg
gcgctgcgcgagcatggcgagcagttcttcatcgacctctgcgatgccgtcgacaacaag
tggatcaacggggtgtcctacaagctgggctggttgcacacgctgggccggcagctgctg
gcctgggccgggcgcgccgacgcgcgcgagctgctggccagcgaacgcctgccggcactg
ctgccggacgtgttggccgacaagaccaacaagaaattccccgatcgcacgccgtcgtca
ccagtgcaggcgccgttggcgcgctatgtcgcgctgctggccgaacgtgatgcctggctg
cgtgccaccgcgctgaatttcctgcacgcgctccgcgccgaagccatgcagcgcctgcag
gcactgaagcgcacgcgccgggtgcagacctacgacgatctgatcgatggcgtggcactg
gccctggaaggcccacagcgtctggcgctggtcaggcagctgcgcgcgcagtaccgcatc
gcgctggtcgatgagttccaggacaccgacgatcgccagtggggcatcttccacaccgtg
ttcggcgattcgccagaggtacgcgaactcggcctggcgccggcgctgttcctgatcggc
gaccccaagcaggcgatctacggattccgcggcggcgacatccacacctacctgaaggcc
aagcaggtggcgcagcaggcgccggtgctggaccagaacttccgctcgcggccggctgtg
ctgcgtgcgctgcaggcgctgtacgacaacggtggcgaagacgccttcctcgaacgcgac
atccagttcgagccggtgcgtcccggtggcgtgcgcagcgatgaggactacctgcgcgac
ggccacgccgccacggcacttaccctgcgcgtgctgcgtagtggcggtgacaaggcgatg
agcgccgatgcctcgcgtgaggcggcgacccaggcctgcgtggccgcgattcaccagatt
ctggtcgaggcgcgtgcgggcaaggccgtgctgcgtgggcagccggtgcggccgggtgac
atcgcggtgctggtgcgctcgcatcgcgaggccacgctggtgcaacgggcgctggcggcg
gtcggtattcctgcggtggcggccggcaagcagagcctgttttccacccctgaagcgcgc
gatcttcgtgcgctgctgctggcgctgctgcaaccggccgacgaaggccgcctgcgtgca
gcgctggccacggtactgctgggccagcgggccagcgcgatcgcggcgatggaacgcgag
ggcgacctgcaacgcggcttccaggcacagctgctgcactggcgcgagcgctggcagcgc
ggtgggcctttcgcggtgatcgccgatgtctgtgccgcacagggtgaacgcctgctggcg
ctgatcgacggcgagcgccgcctgaccaactacctgcagctgggcgaactgctgcaggaa
gcctcggcgcaggcgctgggcatgcatggcctgctggactggctgcaggggcagatggcc
agcgccgaccaggatgacgagcagcagctgctgcgcctggaatcggatgcgcgccgcgtg
cagatcatcaccctgcacaagagcaagggcctggagtatccgctggtgttcctgcccttc
gtcggcatcgacggcggcgcgccgaacaccgcttcgcactgcaccgtccacgtcagcggt
cagcgccagttgcactggaagctggacaaggatgaggtctgggaagcggccagtgcccag
cgcgagcgcgagcagcgcgccgaggatgcacgcctgctgtatgtgggactgacccgcgcc
gagcatgcgctgtggatcgccgcgggtgatctggccgggctgggcaggacacggctggca
ccgctgctgggtgacctgcaggcgctgcgcgcccaggccgacgtgcacatcgatgacagc
gagacaccggccgcgctgccgcagctggcggccgaagtggagggtgaccttccggcggtg
cgtgccctgacccggcgcgtaccccacgactggtgggtgtacagcttcacccagctggca
catgccgacgcgggtgctggcagtgatatcgaagccgccgccaccgagctgccggcgccg
gccgccgacgaaccggccggcccggaactgccgctggagcccgcgctgccggaacccgct
gcggcggccgaggacagcgtggcggtcgacccgcgcttcatgggtagtcgcttcggcaac
gtgctgcacgaagcgatggagaacgtcgacttcgctgcctgggctgattggcagccgggt
ctggaagccccagagggccaggccgaggtgctgcgcaaggcgctgcacgacgaaggctat
gccgacgttgacctggacgatggcgtggcggtgctggtgccgctggtaggccacacgctc
accgtgccgcttccggaaggcggtgcgctgcacagcctgggtgcaggcgagcgacgcgcg
gaaatcgacttccatttcgccatcgaaccgaccacggtaccggcgctgttgcaggtgctg
catgcacatggggtctccagtacgcgtcgcggcttcggccagcgccgccgcctggaaggg
ctgatgaccggcatgatcgacctgacctacgtgcgcgacgggcgctggtacgtgctcgac
tacaaatccaaccgcctgcccggctacagcccggacctgctggccattgccatgcgccac
agcgagtacgacctgcaggcgctgatctacacggtggccctgcatcgctggctgcgtttc
cgcctgggcgcggcctacgactacgagcgcgacatgggcggcatccgctacctgttctgt
cgcggcctggatgccgccggcaacggtgtgcatgtggaccgcttcccgttggcgctggtg
gatgcgctggatgcattgttcgccggtggcgagcaggcccaggccgaactggccgcacgt
gcccgtggagccagcgcatga

DBGET integrated database retrieval system