KEGG   Stenotrophomonas maltophilia JV3: BurJV3_4068Help
Entry
BurJV3_4068       CDS       T01596                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00480  Glutathione metabolism
buj00590  Arachidonic acid metabolism
buj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BurJV3_4068
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BurJV3_4068
Enzymes [BR:buj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BurJV3_4068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEM53380
Position
complement(4522868..4523413)
Genome map
AA seq 181 aa AA seqDB search
MSTPIQDISLTTIDGQPSSLADYQGKVLLLVNVASKCGLTPQYEGLQALYAEKHAQGLEV
LGFPANNFLGQEPGSEAEIQQFCQLTYDVSFPMFSKISVAGEDTHPLYQQLTAAQPQSIG
EGPLRERLASKEIPIHPAPAVLWNFEKFLVGRDGKVVARFAPDVAADDARLREAIEAALA
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccccaatccaggacatttccctcaccaccatcgacggccagccgtcctcgctt
gccgactaccagggcaaggtactgctgctggtcaacgttgcctccaagtgtggcctgacc
ccgcagtacgaaggcctgcaggcgctgtatgcggaaaagcacgcgcagggcctggaagtg
ctgggcttccccgccaacaacttccttggccaggagccgggcagcgaggccgagatccag
cagttctgccagctcacctacgatgtcagtttcccgatgttctccaagatcagcgtggct
ggcgaggacacccacccgctgtaccagcagctgaccgctgcgcagccgcagtcgatcggt
gaaggcccgctgcgcgagcgcctggccagcaaggagatcccgatccatccggcaccggcg
gtgctgtggaacttcgagaagttcctggtcggccgcgatggcaaggtcgtcgcccgcttt
gcgccggacgtggccgccgatgatgcgcgcctgcgcgaggccatcgaggcggcactggcg
gcctga

DBGET integrated database retrieval system