KEGG   Burkholderia sp. KJ006: MYA_0790Help
Entry
MYA_0790          CDS       T02110                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00010  Glycolysis / Gluconeogenesis
buk00030  Pentose phosphate pathway
buk00051  Fructose and mannose metabolism
buk00052  Galactose metabolism
buk00230  Purine metabolism
buk00500  Starch and sucrose metabolism
buk00520  Amino sugar and nucleotide sugar metabolism
buk00521  Streptomycin biosynthesis
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_0790
   00030 Pentose phosphate pathway
    MYA_0790
   00051 Fructose and mannose metabolism
    MYA_0790
   00052 Galactose metabolism
    MYA_0790
   00500 Starch and sucrose metabolism
    MYA_0790
   00520 Amino sugar and nucleotide sugar metabolism
    MYA_0790
  Nucleotide metabolism
   00230 Purine metabolism
    MYA_0790
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MYA_0790
Enzymes [BR:buk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MYA_0790
    5.4.2.8  phosphomannomutase
     MYA_0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFJ85157
UniProt: I2DKI1
Position
1:852403..853797
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVVGKTLDADTARAIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDVGMVPTPVGYFAASVPLALKGGERSVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQIQALYRRIVDERYDTGSGSYEAFDVADQYIARIIGDVKLARPLKLVVDA
GNGVAGPLATRLFKALGCELVERFTDIDGTFPNHHPDPAHPENLQDVIQALKDTDAELGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRHLAQWVKEKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILAKTADP
SAVLNALPDAMSTPELQLKLEEGENFRLIEKLQSEAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVLRFEAETQEGLERIQADFRRVLTAAKPDVGLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatatgacattcgcggcgtggtcggcaagacgctc
gacgccgacacggcgcgcgccatcggccgcgcgttcggcagcgaagtgcgcgcgcaaggc
ggcgacgccgtcgtggtcgcgcgcgacggccgcctgtccgggccggaactcgtcggcgcg
ctggccgatggcctgcgtgcggcgggcgtcgacgtcgtcgacgtcggcatggtgcccacg
ccggtcggctatttcgcggcgagcgtgccgctcgcgctgaagggcggcgagcgcagcgtc
gattcgtgcatcgtcgtcaccggcagccacaacccgcccgactacaacggcttcaagatg
gtgctgcgcggcgcggcgatctacggcgagcagatccaggcgctgtaccgccgcatcgtc
gacgagcgctacgacaccggcagcggctcgtacgaagcattcgacgtggccgatcagtac
atcgcgcgcatcatcggcgacgtgaagctcgcgcgtccgctgaagctcgtcgtcgatgca
ggcaacggcgttgccggcccgcttgccacgcgcctgttcaaggcgctcggctgcgagctg
gtcgagcgcttcaccgacatcgacggcacgttcccgaaccatcaccccgatcccgcgcac
ccggaaaacctgcaggacgtgatccaggcgctgaaggacaccgacgcggaactcggcttc
gcgttcgacggcgacggcgaccgcctcggcgtcgtcacgaaggacggccagatcatctac
ccggaccgccagctgatgctgttcgcggaggaagtgctgtcgcgcaatccgggcgcgcag
atcatctacgacgtgaagtgcacgcgccatctcgcgcagtgggtgaaggagaagggcggc
gagccgctgatgtggaagacgggccactcgctggtgaaggcgaagctgcgcgagaccggt
gcgccgctcgcgggcgagatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacgggctgtacacgggcgcgcggctgcttgagatcctcgcgaagacggccgatccg
agcgcggtgctcaatgcgctgccggacgcgatgagcacgccggaattgcaactcaagctc
gaagaaggcgagaacttccgtctgatcgagaagctgcagagcgaggcgaagttcgacggc
gcggacgaggtcgtgacgatcgacgggctgcgcgtcgagtatccggacggcttcggcctc
gcgcgctcgtcgaacacgacgcccgtggtcgtgctgcgcttcgaggcggagacgcaggaa
gggctcgagcgtatccaggcggatttccgccgcgtgctgacggctgcgaagccggacgtt
ggcctgccgttctga

DBGET integrated database retrieval system