KEGG   Burkholderia sp. KJ006: MYA_0945Help
Entry
MYA_0945          CDS       T02110                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00540  Lipopolysaccharide biosynthesis
buk01100  Metabolic pathways
Module
buk_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    MYA_0945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:buk01005]
    MYA_0945
Enzymes [BR:buk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     MYA_0945
Lipopolysaccharide biosynthesis proteins [BR:buk01005]
 Unusual sugar
  MYA_0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2 NAD_binding_10 KR
Motif
Other DBs
NCBI-ProteinID: AFJ85312
UniProt: I2DKY6
Position
1:1004416..1005408
Genome map
AA seq 330 aa AA seqDB search
MTLIVTGAAGFIGANIVKALNERGESRIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVER
FARGDFGKVRAVFHEGACSDTMETDGRYMMDNNFRYSRAVLDACLAQGAQFLYASSAAIY
GGSTRFVEEREVEAPLNVYGYSKFLFDQVIRRVLPSARSQIAGFRYFNVYGPRETHKGRM
ASVAFHNFNQFRAEGKVKLFGEYNGYAPGEQTRDFVSVEDVAKVNLFFFDHPEKSGIFNL
GTGRAQPFNDIASTVVNTLRALDNLPPLTLAQQVEQGLIEYVAFPDALRGKYQCFTQADQ
TKLRAAGYDAPFLTVQEGVDRYVRWLSGQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatcgtcaccggtgcagccggtttcatcggcgcgaacatcgtcaaggcgctc
aacgagcgcggcgagtcgcgcatcatcgcggtcgacaatctgacgcgcgcggacaagttc
cgtaacctcgtcgattgcgagatcgacgactatctcgacaagaccgaattcgtcgaacgc
ttcgcgcgcggcgatttcggcaaggtgcgcgcggtgttccacgaaggcgcctgttcggac
acgatggaaaccgacggccgctacatgatggacaacaacttccgctacagccgcgcggtg
ctcgatgcgtgcctcgcgcagggcgcgcagttcctgtacgcgtcgtcggcggcgatctac
ggcggctcgacgcgcttcgtcgaggagcgcgaggtcgaggcgccgctgaacgtgtacggc
tactcgaagttcctgttcgaccaggtgatccgccgcgtgctgccgagcgccaggagccag
atcgccgggttccgctacttcaacgtgtacggcccgcgcgagacgcacaaggggcgcatg
gcgtcggtggcgttccacaacttcaaccagttccgcgcggaaggcaaggtcaagctgttc
ggcgagtacaacggttacgcgccgggcgagcagacgcgcgacttcgtgtcggtggaagac
gtcgcgaaggtcaacctgttcttcttcgatcatccggagaagtcgggcatcttcaatctc
ggcacgggccgcgcgcagccgttcaacgacatcgcctcgaccgtcgtcaatacgctgcgt
gcgctcgacaacctgccgccgctcacgctcgcgcagcaggtcgagcagggcttgatcgaa
tacgtggcgttccccgatgcgctgcgcggcaagtaccagtgcttcacgcaggccgaccag
acgaagctgcgcgcggccggctacgacgcgccgttcctgacggtgcaggaaggtgtcgat
cgctacgtgcgttggctgtccggccaggtttaa

DBGET integrated database retrieval system