KEGG   Burkholderia sp. KJ006: MYA_1176Help
Entry
MYA_1176          CDS       T02110                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00790  Folate biosynthesis
buk01100  Metabolic pathways
Module
buk_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYA_1176
Enzymes [BR:buk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MYA_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AFJ85542
UniProt: I2DLL6
Position
1:1258488..1259381
Genome map
AA seq 297 aa AA seqDB search
MSESAVSVSAPAPLQCGRFSLTFERPLVMGILNATPDSFSDGGRFLARDDALRQAERMVA
DGVDLIDIGGESTRPGAPPVPLDEELARVIPLVEALRPLDVPLSIDTYKPAVMRAALAAG
ADLINDIWGFRQPGAIDAVRDGNCGLCAMHMLGEPQTMQVGEPDYDDVVVDVHDFLAARA
QALRDAGIAPQRICVDPGFGFGKAVIDDNYALLAALPDTAPLRPDGRAYPILAGMSRKSM
LGAVIGGKPPLERVAASVAAAVCAVARGAAIVRVHDVAATVDALKVWNAVREAARQR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaatccgcagtcagcgtatccgctcccgcgccgctccagtgcggccgcttctcg
ctcaccttcgagcgcccgctcgtgatgggcatcctcaacgccacacccgattcgttttcc
gacggcggccgcttcctcgcgcgcgacgatgcgttgcgccaggccgagcggatggttgcc
gacggcgtcgatctgatcgacatcggcggcgaatcgacgcgccccggcgcgccgcccgtg
ccgctcgacgaggagctcgcgcgcgtgatcccgctcgtcgaagcgttgcgcccgctcgac
gtgccgctgtcgatcgacacgtacaaaccggcggtgatgcgcgcggcgctcgcggccggc
gccgacctgatcaacgacatctgggggttccgacagccgggcgcgatcgatgcggtgcgc
gacggcaattgcgggttgtgcgcgatgcacatgctcggcgagccgcagaccatgcaggtg
ggcgagccggactacgacgacgtcgtcgtcgacgtgcacgactttctcgccgcgcgcgcg
caggcgctgcgcgatgcgggcatcgcgccgcagcggatctgcgtcgacccgggcttcggc
ttcggcaaggcggtgatcgacgacaactacgcgctgctggccgcgttgcccgacacggcg
ccgctgcggcccgacgggcgcgcctatccgatcctcgcgggcatgtcgcgcaagtcgatg
ctcggcgcggtgatcggcggcaagccgccgctcgagcgcgtcgcggcgagcgtggcggcg
gccgtgtgcgcggtcgcacgcggcgccgcgatcgtgcgcgtgcacgacgtggccgcgacg
gtcgatgcattgaaagtttggaacgccgtgcgcgaagccgcgcggcaacgataa

DBGET integrated database retrieval system