KEGG   Burkholderia sp. KJ006: MYA_1797Help
Entry
MYA_1797          CDS       T02110                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00900  Terpenoid backbone biosynthesis
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MYA_1797
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MYA_1797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFJ86158
UniProt: I2DND2
Position
1:complement(1932551..1933747)
Genome map
AA seq 398 aa AA seqDB search
MQKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDA
ATAAHVEAKLRAAGSKTTVLYGPQALVDVSASDGCDTVVAAIVGAAGLAPSLAAARAGKR
ILLANKESLVMSGGIFMDAVRDHGAILLPVDSEHNAIFQCMPRDENEHGGISKIILTASG
GPFRTREPATLADVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWIFGLPGDRID
VLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVDQLDLAQIAQLSF
EKPDYARFPCLALALKALEEGGIASAALNAANEVAVEAFLERRIGFMAIAATVDAVLNAL
PNRSPNGLDDVLAADADARRLAAGFIAKAPAPRVERIV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacgtctgacactgctcggttccacgggctcgatcggagacagcacgctcgac
gtggtcgcccgccatcccgagcgtttttcggtgtacgcgctgaccgcgcatcgcaacggc
gacaagctcgtcgagcaatgcctgcgcttcgcgccggaagtcgcggtggtcggcgacgcg
gcgaccgccgcgcacgtcgaagcaaagctgcgcgccgcgggcagcaagaccacggtgctg
tatggtccgcaggcgctcgtcgacgtgtcggcgagcgacggctgcgacacggtcgtcgcg
gcgatcgtcggcgcggccggcctcgcgccgagcctcgcggccgcgcgcgcgggcaagcgc
atcctgctcgcgaacaaggaatcgctggtgatgtcgggcgggatcttcatggacgcggtg
cgcgaccatggcgcgatcctgctgccggtcgacagcgagcacaacgcgatcttccagtgc
atgccgcgcgacgagaacgagcacggtggcatctcgaagatcatcctgaccgcgtcgggc
ggcccgttccgcacgcgcgagccggccacgctcgccgacgtgacgccggacgaggcgtgc
aagcatccgaactgggtgatgggccgcaagatctccgtcgattcggcgacgatgatgaac
aagggcctcgaggtgatcgaggcgcactggatcttcggtctgccgggcgaccggatcgac
gtgctgatccacccgcagagcgtgatccattcgctggtgtcgtatcgcgacgggtcggtg
ctcgcgcagctcggcaaccccgacatgcgtacgccgatcgcgcacgcgctcgcgttcccg
gagcgcgtcgacgccggcgtcgatcagctcgacctcgcgcagatcgcgcagctgtcgttc
gagaagccggattacgcacgcttcccgtgtctcgcgctcgcgctgaaggcgcttgaagag
ggcgggatcgcgagcgccgcattgaacgcggcgaacgaagtcgcggtcgaagcgtttctc
gagcgccggatcggcttcatggcgattgcggcgacggtcgacgcggtgctcaacgcactg
ccgaaccgcagcccgaacgggctcgacgacgtcctggcggccgatgccgacgcgcgccgt
cttgccgccgggttcattgcaaaagcgcctgcgcctcgcgtggagcgtatcgtctga

DBGET integrated database retrieval system