KEGG   Burkholderia sp. KJ006: MYA_2209Help
Entry
MYA_2209          CDS       T02110                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00450  Selenocompound metabolism
buk00970  Aminoacyl-tRNA biosynthesis
buk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MYA_2209
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MYA_2209
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:buk01007]
    MYA_2209
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:buk03016]
    MYA_2209
Enzymes [BR:buk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MYA_2209
Amino acid related enzymes [BR:buk01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MYA_2209
Transfer RNA biogenesis [BR:buk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MYA_2209
 Prokaryotic type
   Other AARSs
    MYA_2209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AFJ86569
UniProt: I2DPJ3
Position
1:2398383..2400524
Genome map
AA seq 713 aa AA seqDB search
MQAAAPQGSRQILVTSALPYANGQIHIGHLVEYIQTDIWVRTLRMHGHEVYYIGADDTHG
TPIMLRAEMEGLTPKQLIDRVWAEHKRDFDSFGVSFDNFYSTDSDENRVLSEKIYVALKE
NGLIAEREIEQAYDPVKEMFLPDRFIKGECPKCHAKDQYGDSCEVCGSTYLPTDLLNPYS
VVSGATPVRKTSTHHFFRLSDPRCESFLRDWVSGLAQPEATNKMREWLGDAGEAKLADWD
ISRDAPYFGFEIPGAPGKYFYVWLDAPVGYYASFKNLCERKGIDFDAWVRPGATAEQYHF
IGKDILYFHTLFWPAMLEFSGHRTPTNVFAHGFLTVDGAKMSKSRGTFITAQSYIDTGLN
PEWLRYYFAAKLNATMEDIDLNLDDFQARVNSDLVGKYVNIASRAAGFLIKRFDGRVQDS
AMNHPLVAKLRSAIDSIAAHYEAREYSRALRQTMELADEVNAYVDGAKPWELAKDPANAV
ALHETCSVSLEAFRLLSLALKPVMPRVAQAVEAFFGIAPLAWADAAKPLSSAQPINAYQH
LMTRVDAKQIDALLAANRGSLQADGAAAAAASGATGAAAAKDAKPAKANAKAAAANAADD
GPISIDDFAKIDLRIAKIVACQAVEGSDKLLQLTLDVGEEKTRNVFSGIKSAYQPEQLVG
KLTVMVANLAPRKMKFGLSEGMVLAASAADEKAEPGLYILEPHSGAKPGMRVK
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggccgcggcgccgcaaggcagccgccagatcctcgttacgtccgcccttccctat
gccaacggccagatccacatcggccatctggtcgagtacatccagaccgacatctgggtg
cggacgctgcgaatgcacgggcacgaggtctactacatcggcgccgacgatacgcacggc
acgccgatcatgctgcgcgccgagatggaaggcctcacgccgaagcagctgatcgaccgc
gtgtgggccgagcacaagcgcgacttcgacagcttcggcgtgtcgttcgacaatttctat
tcgaccgattcggacgaaaaccgcgtgctcagcgagaagatctacgtcgcgctgaaggaa
aacggcctgatcgccgagcgcgagatcgagcaggcgtacgacccggtcaaggaaatgttc
ctgccggaccgcttcatcaagggcgaatgcccgaagtgccacgcgaaggaccagtacggc
gacagctgcgaagtatgcggctcgacctacctgcccaccgacctgctgaacccgtactcg
gtcgtgtccggcgcgacgccggtgcgcaagacgtcgacgcaccacttcttccgcctgtcc
gacccgcgctgcgagtcgttcctgcgcgactgggtcagcggcctcgcgcagcccgaagcg
accaacaagatgcgcgaatggctcggcgacgccggcgaagcgaagctcgccgactgggac
atctcgcgcgacgcgccctacttcggcttcgaaatccccggcgcgccgggcaagtatttc
tacgtgtggctcgacgcgccggtcggctactacgcgagcttcaagaacctgtgcgagcgc
aagggcatcgacttcgacgcgtgggtccgcccgggcgcgacggccgagcagtatcacttc
atcggcaaggacatcctgtatttccacacgctgttctggccggcgatgctcgaattttcg
ggccaccgcacgccgaccaacgtgttcgcgcacggcttcctgaccgtcgacggcgcgaag
atgtcgaagtcgcgcggcacgttcatcaccgcgcagagctacatcgacacgggcctgaac
cccgagtggctgcgctactacttcgccgcgaagctgaacgcgacgatggaagacatcgac
ctgaacctcgacgacttccaggcgcgcgtgaacagcgatctggtcggcaagtacgtgaac
atcgcgagccgcgcggccggcttcctgatcaagcgcttcgacggccgcgtgcaggacagc
gcgatgaatcatccgctcgtcgcgaagctgcgcagcgcgatcgactcgatcgccgcgcac
tacgaagcccgcgaatacagccgcgcgctgcgccagacgatggagctcgccgacgaagtc
aacgcgtacgtcgacggcgcgaagccgtgggagctcgcgaaggacccggccaacgcggtc
gcgctgcacgagacctgcagcgtgagcctcgaggcgttccgcctgctgtcgctcgcgctg
aagccggtgatgccgcgcgtcgcgcaggccgtcgaggcgttcttcgggatcgcgccgctc
gcatgggccgatgccgcgaagccgctgtcgtccgcgcagccgatcaacgcgtaccagcat
ctgatgacgcgcgtcgacgcgaagcagatcgacgcgctgctcgccgcgaaccgcggttcg
ctgcaggccgacggcgctgctgcggcggccgcctcgggcgcgaccggcgccgccgccgcg
aaggacgcgaagccggccaaggcgaacgcgaaggccgccgccgcgaacgccgcggacgac
ggcccgatctcgatcgacgacttcgcgaagatcgatctgcgcatcgcgaagatcgtcgcg
tgccaggccgtcgaaggctcggacaagctgctgcagctcacgctcgacgtcggcgaggaa
aagacccgcaacgtgttctcgggcatcaagtcggcgtatcagcccgagcagctcgtcggc
aagctgacggtgatggtcgcgaacctcgcgccgcgcaagatgaagttcgggctgtccgaa
gggatggtgctcgccgcgtcggccgccgacgagaaggccgagccgggcctctacatcctc
gagccgcacagcggcgcgaagcccggcatgcgcgtgaagtaa

DBGET integrated database retrieval system