KEGG   Burkholderia sp. KJ006: MYA_2279Help
Entry
MYA_2279          CDS       T02110                                 

Definition
(GenBank) Phosphopantothenoylcysteine decarboxylase / Phosphopantothenoylcysteine synthetase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00770  Pantothenate and CoA biosynthesis
buk01100  Metabolic pathways
Module
buk_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MYA_2279
Enzymes [BR:buk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     MYA_2279
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     MYA_2279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein FMN_red
Motif
Other DBs
NCBI-ProteinID: AFJ86639
UniProt: I2DPR3
Position
1:2471704..2472969
Genome map
AA seq 421 aa AA seqDB search
MSTAGFTPAVPFDPWRPELAHAELAGKHLVLGLTGGIACYKIAELTRLLTKAGATVQVVM
TEAAAQFITPITMQALSGRPVYTSQWDARVDNNMAHIDLSREADAIVIAPASTDFLAKLA
HGFADDLLSTLCVARDCPLLVVPAMNRQMWQNPATQRNAAQLRADGVSVLGPDSGAQACG
EVGDGRMLEPEAIYEAIVAHFAPKLLAHRRVLITAGPTFEPLDPVRGLTNRSSGKMGFAL
ARAAQQAGADVHLVAGPVALDTPWGVYRQDVQTAQQMYDAVMHAVSDADIFIAVAAVADW
RVEQPAEHKMKKTADRKMPALTFVENPDILASVAALPDPPYCVGFAAESGDLDVHGDEKR
KRKNVPLLIGNLGPLTFGRDDNEVVLFEAAGLTPLPRAPKDELAHVLVAEIARRLPDNRL
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacggccggcttcacgccggccgttccgtttgatccttggagacccgagttggca
cacgcagaactcgcaggaaaacacctcgtcctcggcctcacgggcggcatcgcctgctac
aagatcgccgagctcacacggctgctgacgaaggccggcgcgaccgtccaggtcgtgatg
accgaagccgccgcgcagttcatcacgcccatcacgatgcaggcgctgtccggccggccc
gtctacacgagccagtgggacgcccgcgtcgacaacaacatggcgcacatcgacctgtcg
cgcgaagccgatgcgatcgtgatcgcgccggcctccaccgacttcctcgcgaagctcgca
cacgggttcgccgacgacctgctgtcgacgctgtgcgtcgcgcgcgactgcccgctgctc
gtcgtgccggcgatgaaccggcagatgtggcagaacccggccacccagcgcaatgcggcg
cagctgcgggccgacggcgtgtcggtgctcggccccgattcgggcgcgcaggcgtgcggc
gaggtcggcgacggccgcatgctcgagcccgaggcgatctacgaagcgatcgtcgcgcac
tttgcgccgaagctgctcgcgcaccgccgcgtgctgatcacggccggcccgacgttcgag
ccgctcgatccggtgcgcggcctcacgaaccgctcgagcggcaagatgggcttcgcgctc
gcgcgcgccgcgcagcaggccggcgcggacgtgcatctggtggccgggccggtcgcgctc
gacacgccgtggggcgtgtaccggcaggacgtgcagaccgcgcagcagatgtacgacgcg
gtcatgcacgcggtatcggacgcggacatcttcatcgcggtggccgcggtcgccgactgg
cgcgtcgagcagccggccgagcacaagatgaagaagaccgccgatcgcaagatgccggcg
ctcacgttcgtcgagaaccccgacatcctcgcgtcggtcgccgcgctgcccgatccgccg
tactgcgtcggcttcgcggccgaaagcggcgacctcgacgtgcacggcgacgaaaagcgc
aagcgcaagaacgtgccgctgctgatcggcaacctcggcccgctgacgttcggccgcgac
gacaacgaagtggtgctgttcgaggcggccggcctcacgccgctgccgcgcgcgccgaag
gacgaactcgcccacgtgctcgtcgccgaaatcgcgcggcgcctgcccgacaaccgactg
atctga

DBGET integrated database retrieval system